Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2100
Gene name
Locationscaffold_185:12594..14430
Strand-
Gene length (bp)1836
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01894 UPF0047 Uncharacterised protein family UPF0047 1.6E-36 334 454
PF10276 zf-CHCC Zinc-finger domain 6.2E-14 113 148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AUI1|LBSA_EMENI Lactobacillus shifted protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lbsA PE=1 SV=1 60 167 6.0E-52
sp|O14155|YE72_SCHPO UPF0047 protein C4A8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.02c PE=3 SV=1 315 457 1.0E-44
sp|P0AF48|YJBQ_ECOLI UPF0047 protein YjbQ OS=Escherichia coli (strain K12) GN=yjbQ PE=3 SV=1 317 458 2.0E-39
sp|P0AF49|YJBQ_ECO57 UPF0047 protein YjbQ OS=Escherichia coli O157:H7 GN=yjbQ PE=3 SV=1 317 458 2.0E-39
sp|P0A2L1|YJBQ_SALTY UPF0047 protein YjbQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yjbQ PE=3 SV=1 317 458 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AUI1|LBSA_EMENI Lactobacillus shifted protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lbsA PE=1 SV=1 60 167 6.0E-52
sp|O14155|YE72_SCHPO UPF0047 protein C4A8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.02c PE=3 SV=1 315 457 1.0E-44
sp|P0AF48|YJBQ_ECOLI UPF0047 protein YjbQ OS=Escherichia coli (strain K12) GN=yjbQ PE=3 SV=1 317 458 2.0E-39
sp|P0AF49|YJBQ_ECO57 UPF0047 protein YjbQ OS=Escherichia coli O157:H7 GN=yjbQ PE=3 SV=1 317 458 2.0E-39
sp|P0A2L1|YJBQ_SALTY UPF0047 protein YjbQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yjbQ PE=3 SV=1 317 458 1.0E-31
sp|P0A2L2|YJBQ_SALTI UPF0047 protein YjbQ OS=Salmonella typhi GN=yjbQ PE=3 SV=1 317 458 1.0E-31
sp|P74125|Y1880_SYNY3 UPF0047 protein sll1880 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1880 PE=3 SV=1 339 458 3.0E-26
sp|Q58481|Y1081_METJA UPF0047 protein MJ1081 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1081 PE=3 SV=1 334 459 2.0E-15
sp|O05243|YUGU_BACSU UPF0047 protein YugU OS=Bacillus subtilis (strain 168) GN=yugU PE=3 SV=2 320 446 9.0E-14
sp|O26865|Y771_METTH UPF0047 protein MTH_771 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_771 PE=3 SV=1 315 458 1.0E-12
sp|P23934|NDUS6_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Bos taurus GN=NDUFS6 PE=1 SV=2 98 153 2.0E-12
sp|O28229|Y2050_ARCFU UPF0047 protein AF_2050 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2050 PE=3 SV=1 321 452 5.0E-12
sp|Q0MQH5|NDUS6_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pongo pygmaeus GN=NDUFS6 PE=2 SV=1 98 153 3.0E-11
sp|P52504|NDUS6_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Rattus norvegicus GN=Ndufs6 PE=3 SV=1 98 153 3.0E-11
sp|Q0MQH7|NDUS6_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pan troglodytes GN=NDUFS6 PE=2 SV=1 98 153 3.0E-11
sp|O75380|NDUS6_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens GN=NDUFS6 PE=1 SV=1 98 153 3.0E-11
sp|P52503|NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Mus musculus GN=Ndufs6 PE=1 SV=2 98 153 4.0E-11
sp|Q0MQH6|NDUS6_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS6 PE=2 SV=1 98 152 4.0E-11
sp|Q4R5X8|NDUS6_MACFA NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Macaca fascicularis GN=NDUFS6 PE=2 SV=1 98 148 5.0E-10
sp|Q19724|NDUS6_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Caenorhabditis elegans GN=nduf-6 PE=3 SV=1 80 155 1.0E-09
sp|Q9M9M6|NDUS6_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Arabidopsis thaliana GN=At3g03070 PE=3 SV=1 97 153 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1201 0.1723 0.0719 0.1187 0.9546 0.0455 0.0718 0.054 0.059 0.0933

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1105
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|722
Ophiocordyceps australis map64 (Brazil) OphauB2|5666
Ophiocordyceps camponoti-floridani Ophcf2|05031
Ophiocordyceps camponoti-rufipedis Ophun1|4603
Ophiocordyceps kimflemingae Ophio5|2100 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1012

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2100
MADFRLRPIGLLARSLRAPQRTLSNSHHLFEAATPVKPSTETAIEHARTKELDQPKELGQAPNRVGIWSRSQKPR
TTAMTGPRFEQTDMSLQPQPMSAMEMIHKQPVRWTHDRVVSCEGGGGPSGHPRIFINTDKPEIAVCNYCGLPFAN
EHNRKHLESLPETSYPLGCSLDGLASDCTKANAGGGLFIVTSEVKTQKVSIRIGFPISPPRTGCVLSRHVEAETR
ALPHNRIVMYQVPPRFQPHQSMISSGFPQPKPSMPQRTPAISTTGTFALVLLLFVALFPDLFHVLWTLPFSLLRP
AQLKSSGPTLQPAAMSWFQKELKLPSKARGSYLITDEVVSALPEIRGYKIGLLNLFVQHTSCALSLNENWDEDVR
ADMSDAMDRIVPNNGPKGEQLYRHAAEGPDDMPAHIKTALVGASVNIPIRDGKLALGTWQGIWHLEFRTSRHSRR
VMATIQGEKM
Coding >Ophio5|2100
ATGGCCGACTTTCGGCTGAGGCCAATTGGCCTCCTCGCCCGCAGCCTGCGAGCTCCCCAGCGAACCTTGAGCAAC
TCCCATCACCTTTTCGAAGCTGCCACTCCCGTAAAGCCGAGCACCGAAACGGCCATCGAGCATGCCCGGACCAAG
GAGCTCGACCAGCCCAAGGAACTCGGCCAGGCGCCCAATCGAGTCGGTATCTGGTCTCGAAGCCAGAAGCCGCGC
ACCACGGCCATGACGGGTCCTCGATTTGAGCAAACAGACATGAGCCTACAGCCTCAACCCATGTCGGCCATGGAG
ATGATTCACAAACAGCCCGTTCGGTGGACGCATGACCGCGTCGTATCGTGCGAAGGCGGCGGCGGTCCGTCCGGG
CATCCCAGGATATTCATCAACACCGACAAGCCGGAGATTGCCGTCTGCAACTACTGCGGTTTGCCCTTTGCCAAC
GAACACAACAGGAAGCATCTCGAGTCGCTTCCCGAAACGTCGTACCCTTTGGGCTGTTCGCTCGACGGTCTCGCC
TCCGACTGCACAAAAGCAAACGCAGGCGGGGGACTTTTCATTGTCACGAGTGAGGTGAAAACACAGAAAGTTTCT
ATCCGCATTGGATTCCCAATCTCACCGCCTCGAACCGGTTGCGTACTCTCAAGACATGTCGAGGCTGAAACTCGA
GCCTTACCCCATAATCGCATCGTAATGTACCAGGTACCCCCTCGCTTTCAGCCGCACCAATCAATGATTTCATCG
GGATTTCCGCAACCTAAACCATCAATGCCTCAACGAACCCCCGCCATCTCCACTACAGGCACCTTTGCCCTCGTC
CTCTTGCTCTTCGTCGCGCTGTTCCCGGACCTGTTCCACGTCCTCTGGACTCTACCGTTCAGTCTCCTCCGGCCG
GCCCAGCTCAAGTCTAGCGGACCTACCCTGCAGCCGGCAGCCATGTCATGGTTTCAGAAGGAACTCAAACTCCCG
TCGAAAGCTAGAGGCTCTTACTTGATCACAGACGAGGTCGTATCCGCTCTGCCGGAGATACGAGGTTACAAAATC
GGCCTCTTGAACTTGTTCGTGCAGCACACGAGTTGCGCTCTGAGCTTGAACGAAAACTGGGATGAAGATGTAAGG
GCAGACATGAGCGACGCCATGGATCGCATCGTCCCGAACAATGGCCCCAAAGGCGAACAACTTTACCGTCACGCC
GCCGAGGGACCAGATGACATGCCGGCACACATCAAGACTGCCTTGGTCGGAGCTAGCGTAAACATTCCCATCAGA
GATGGAAAGCTGGCGTTGGGTACGTGGCAGGGAATCTGGCACCTCGAATTCCGGACGAGCAGACATTCACGAAGA
GTCATGGCGACCATCCAGGGCGAGAAGATG
Transcript >Ophio5|2100
ATGGCCGACTTTCGGCTGAGGCCAATTGGCCTCCTCGCCCGCAGCCTGCGAGCTCCCCAGCGAACCTTGAGCAAC
TCCCATCACCTTTTCGAAGCTGCCACTCCCGTAAAGCCGAGCACCGAAACGGCCATCGAGCATGCCCGGACCAAG
GAGCTCGACCAGCCCAAGGAACTCGGCCAGGCGCCCAATCGAGTCGGTATCTGGTCTCGAAGCCAGAAGCCGCGC
ACCACGGCCATGACGGGTCCTCGATTTGAGCAAACAGACATGAGCCTACAGCCTCAACCCATGTCGGCCATGGAG
ATGATTCACAAACAGCCCGTTCGGTGGACGCATGACCGCGTCGTATCGTGCGAAGGCGGCGGCGGTCCGTCCGGG
CATCCCAGGATATTCATCAACACCGACAAGCCGGAGATTGCCGTCTGCAACTACTGCGGTTTGCCCTTTGCCAAC
GAACACAACAGGAAGCATCTCGAGTCGCTTCCCGAAACGTCGTACCCTTTGGGCTGTTCGCTCGACGGTCTCGCC
TCCGACTGCACAAAAGCAAACGCAGGCGGGGGACTTTTCATTGTCACGAGTGAGGTGAAAACACAGAAAGTTTCT
ATCCGCATTGGATTCCCAATCTCACCGCCTCGAACCGGTTGCGTACTCTCAAGACATGTCGAGGCTGAAACTCGA
GCCTTACCCCATAATCGCATCGTAATGTACCAGGTACCCCCTCGCTTTCAGCCGCACCAATCAATGATTTCATCG
GGATTTCCGCAACCTAAACCATCAATGCCTCAACGAACCCCCGCCATCTCCACTACAGGCACCTTTGCCCTCGTC
CTCTTGCTCTTCGTCGCGCTGTTCCCGGACCTGTTCCACGTCCTCTGGACTCTACCGTTCAGTCTCCTCCGGCCG
GCCCAGCTCAAGTCTAGCGGACCTACCCTGCAGCCGGCAGCCATGTCATGGTTTCAGAAGGAACTCAAACTCCCG
TCGAAAGCTAGAGGCTCTTACTTGATCACAGACGAGGTCGTATCCGCTCTGCCGGAGATACGAGGTTACAAAATC
GGCCTCTTGAACTTGTTCGTGCAGCACACGAGTTGCGCTCTGAGCTTGAACGAAAACTGGGATGAAGATGTAAGG
GCAGACATGAGCGACGCCATGGATCGCATCGTCCCGAACAATGGCCCCAAAGGCGAACAACTTTACCGTCACGCC
GCCGAGGGACCAGATGACATGCCGGCACACATCAAGACTGCCTTGGTCGGAGCTAGCGTAAACATTCCCATCAGA
GATGGAAAGCTGGCGTTGGGTACGTGGCAGGGAATCTGGCACCTCGAATTCCGGACGAGCAGACATTCACGAAGA
GTCATGGCGACCATCCAGGGCGAGAAGATGTGA
Gene >Ophio5|2100
ATGGCCGACTTTCGGCTGAGGCCAATTGGCCTCCTCGCCCGCAGCCTGCGAGCTCCCCAGCGAACCTTGAGCAAC
TCCCATCACCTTTTCGAAGCTGCCACTCCCGTAAAGCCGAGCACCGAAACGGCCATCGAGCATGCCCGGACCAAG
GAGCTCGACCAGCCCAAGGAACTCGGCCAGGCGCCCAATCGAGTCGGTATCTGGTCTCGAAGCCAGAAGCCGCGC
ACCACGGCCATGACGGGTCCTCGATTTGAGCAAACAGACATGAGCCTACAGGTTCGCGAAGGCGGTTCCCAAAAT
ATGCGTGGCTGAGGGATCGCTGATGGCACGGCAGCCTCAACCCATGTCGGCCATGGAGATGATTCACAAACAGCC
CGTTCGGTGGACGCATGACCGCGTCGTATCGTGCGAAGGCGGCGGCGGTCCGTCCGGGCATCCCAGGATATTCAT
CAACACCGACAAGCCGGAGATTGCCGTCTGCAACTACTGCGGTTTGCCCTTTGTGTGTCTCGCATAGCAGGCAGT
CGAGTCCATACAGCAGGCACTGACTGCAGCTCAGGCCAACGAACACAACAGGAAGCATCTCGAGTCGCTTCCCGA
AACGTCGTACCCTTTGGGGTGAGGCATCGACATGACAGAGGGGAGTTGAACCGGAGAGTGGATTCCTTGCTGTAG
TATCTCGTCACCCTCGATACTATCAGGAGCAATGTCCAGCAAACTAGAACTGCATGACCGCCAGGCAGCTGTTCG
CTCGACGGTCTCGCCTCCGACTGCACAAAAGCAAACGCAGGCGGGGGACTTTTCATTGTCACGAGTGAGGTGAAA
ACACAGAAAGTTTCTATCCGCATTGGATTCCCAATCTCACCGCCTCGAACCGGTTGCGTACTCTCAAGACATGTC
GAGGCTGAAACTCGAGCCTTACCCCATAATCGCATCGTAATGTACCAGGTACCCCCTCGCTTTCAGCCGCACCAA
TCAATGATTTCATCGGGATTTCCGCAACCTAAACCATCAATGCCTCAACGAACCCCCGCCATCTCCACTACAGGC
ACCTTTGCCCTCGTCCTCTTGCTCTTCGTCGCGCTGTTCCCGGACCTGTTCCACGTCCTCTGGACTCTACCGTTC
AGTCTCCTCCGGCCGGCCCAGCTCAAGTCTAGCGGACCTACCCTGCAGCCGGCAGCCATGTCATGGTTTCAGAAG
GAACTCAAACTCCCGTCGAAAGCTAGAGGCTCTTACTTGATCACAGACGAGGTCGTATCCGCTCTGCCGGAGATA
CGAGGTTACAAAATCGGCCTCTTGAACTTGTTCGTGCAGCACACGAGTTGCGCTCTGAGCTTGAACGAAAACTGT
AGGTGACGTCAATTGGCGGGATCGCAGTCGGGAGGCTGACGACAATGCGCGCAGGGGATGAAGATGTAAGGGCAG
ACATGAGCGACGCCATGGATCGCATCGTCCCGAACAATGGCCCCAAAGGCGAACAACTTTACCGTCACGCGTAAG
TCGACAGCATTATACCGCCTGTGTGGGATTGACCAGCCGTAGCGCCGAGGGACCAGATGACATGCCGGTAAGCGC
CCGCGAGAGCTAATGCCTGTGCCTTTGAGAGCTGAACCCGTTCACCTAGGCACACATCAAGACTGCCTTGGTCGG
AGCTAGCGTAAACATTCCCATCAGAGATGGAAAGCTGGTAACTCGCTGTCCACACAACCGAAAACGGCCTGGAAG
CTGACATATACGGAGGCGTTGGGTACGTGGCAGGGAATCTGGCACCTCGAATTCCGGACGAGCAGACATTCACGA
AGAGTCATGGCGACCATCCAGGGCGAGAAGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail