Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|21
Gene name
Locationscaffold_1:43789..46571
Strand-
Gene length (bp)2782
Transcript length (bp)2610
Coding sequence length (bp)2607
Protein length (aa) 869

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 6.3E-73 441 715
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.3E-36 28 209
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.9E-34 229 430

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 13 777 5.0E-157
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 19 766 5.0E-118
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 25 749 3.0E-32
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 28 754 2.0E-31
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 76 750 4.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 13 777 5.0E-157
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 19 766 5.0E-118
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 25 749 3.0E-32
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 28 754 2.0E-31
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 76 750 4.0E-31
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 76 748 2.0E-28
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 78 749 3.0E-27
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 77 748 4.0E-26
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 350 749 1.0E-25
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 77 749 2.0E-25
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 77 749 2.0E-25
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 366 817 1.0E-24
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 35 754 2.0E-24
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 350 786 2.0E-22
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 327 749 5.0E-22
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 357 747 1.0E-21
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 30 761 2.0E-21
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 351 750 9.0E-19
sp|Q91YT8|CSCL1_MOUSE CSC1-like protein 1 OS=Mus musculus GN=Tmem63a PE=1 SV=1 75 683 5.0E-16
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 185 759 1.0E-15
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 75 682 4.0E-15
sp|O94886|CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens GN=TMEM63A PE=1 SV=3 75 682 2.0E-14
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 419 737 7.0E-13
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 389 750 2.0E-10
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 411 750 3.0E-10
sp|Q5T3F8|CSCL2_HUMAN CSC1-like protein 2 OS=Homo sapiens GN=TMEM63B PE=1 SV=1 188 733 2.0E-07
sp|Q3TWI9|CSCL2_MOUSE CSC1-like protein 2 OS=Mus musculus GN=Tmem63b PE=1 SV=1 188 733 1.0E-06
sp|Q9P1W3|CSC1_HUMAN Calcium permeable stress-gated cation channel 1 OS=Homo sapiens GN=TMEM63C PE=2 SV=1 357 733 2.0E-06
sp|Q8CBX0|CSC1_MOUSE Calcium permeable stress-gated cation channel 1 OS=Mus musculus GN=Tmem63c PE=1 SV=1 357 733 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Transmembrane domain 0.1695 0.1451 0.023 0.3756 0.1331 0.0028 0.2252 0.7007 0.6001 0.0257

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 107 126 19
3 185 207 22
4 445 467 22
5 487 509 22
6 530 552 22
7 589 611 22
8 632 654 22
9 659 681 22
10 694 716 22
11 721 743 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 35.24 19.06 51.43
CcL In ants, during behavior modification 43.85 22.40 65.30
CcD In ants, recently dead 36.04 19.59 52.50

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.379818 no
SC16a CcD 0.937681 no
CcL CcD 0.430491 no

Orthologs

Orthofinder run ID4
Orthogroup4200
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3539
Ophiocordyceps australis map64 (Brazil) OphauB2|1090
Ophiocordyceps camponoti-floridani Ophcf2|03617
Ophiocordyceps camponoti-rufipedis Ophun1|6142
Ophiocordyceps kimflemingae Ophio5|21 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8546

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|21
MLQGTQNETCNPEDYVKPPSKNQKDLEVQLILSLILGVSALVAFCILRPRWPALYSARKRRLDADMAPPALSNSC
FGWVPHLLRVTDEQVLASAGLDAFVFLAFFKMATRLFMTMSFFAVVVLWPINSHYRDFQVGLGEGRNPVGNSSAA
AYYHDLYGPIRPPLYRQSAALDALPGTGEDKSRVRTYLWAYVVFTYFFVGLTLYAINRETFRIIRLRQKYLGSQS
TITDRTFRLTGIPLEYRSDQKLKDMIEGLGIGLVDSVTLCRNWKQLDALVAHRDKTLRKLEATWAQYLKQQQSVT
KQHNHFTQTANTGLLNDEEQPDSSSRLLASNPNQPHVVEGERPWINIWYGPLSMRRRRVDALDYYQERLRRLDER
VAEARGKEYEATDMALVTMDSVASCQMVVQARIDPRPGCFLTKLSPSPADLVWRNTYSPRGIRRLKSWGITIFIT
VLTLLWIFPTALLASWLSVCTIKAVLPSFSKWLSRHPIIYSLFQNGVPTLVVSLLNVAVPYLYDWLSNHQGMMSQ
GDVELSVISKNFFFTFFNTFFVFAVSRTGFDFWSVLQKLLKDTSKIPAAIAADVEDLSIFYINFIMLQGVGLMPF
RILEVGSVFLYPIYRFMSSTPRDYAELQKPPVFQYGFYLPTALLVFNLCLIYSVLMWGFAILVFGTVYFLLGHLT
FKYMVLYAMDQPQHATGGAWRIICHRIVIGLVVFEVVMIGQIASLAAFVQSVAVLPLIPFTIWYSYYFKRRFEPL
TKYIALRAIGSGGSQSTQEGSGDDHESQPLRGLMRRQSTLDEYMEKDLVFVNPSLVTSLSQPWIYKDPPQPLSSG
EGAAGAEPERSSPARPALILPDADRSLGIGDDNVWADSSRGERR
Coding >Ophio5|21
ATGCTTCAGGGCACCCAGAACGAGACATGCAACCCGGAAGACTACGTCAAGCCGCCGTCCAAGAACCAAAAGGAC
CTCGAGGTTCAGCTCATTCTCTCCCTGATCCTCGGCGTCTCAGCGCTCGTCGCCTTCTGCATATTGCGCCCCCGA
TGGCCTGCTCTCTATTCTGCCCGCAAGCGTCGTCTCGACGCAGACATGGCTCCTCCCGCCCTCTCCAACTCGTGC
TTCGGCTGGGTCCCTCACCTACTTAGAGTTACGGATGAGCAAGTTCTGGCTTCCGCTGGGCTCGATGCCTTTGTC
TTTTTGGCTTTCTTCAAGATGGCGACGCGGCTTTTCATGACCATGTCCTTTTTCGCCGTCGTCGTCCTCTGGCCC
ATCAACTCCCATTACCGCGACTTTCAAGTCGGCCTCGGCGAAGGCCGTAACCCTGTTGGCAACAGCAGCGCCGCA
GCCTACTACCACGACCTGTACGGCCCTATTCGACCTCCCCTCTACCGCCAGTCAGCCGCTCTCGATGCACTCCCC
GGAACTGGCGAAGACAAGAGTCGCGTCCGCACCTACCTGTGGGCATACGTTGTCTTCACCTACTTCTTCGTCGGC
CTGACTCTCTACGCCATCAACCGGGAGACTTTTCGCATCATCCGCCTGAGGCAAAAATATCTCGGATCGCAGTCC
ACCATTACCGATCGCACATTCCGTCTGACGGGTATACCGCTTGAGTATCGATCTGATCAGAAACTCAAGGATATG
ATTGAGGGACTCGGCATTGGCCTCGTTGACTCCGTTACGCTGTGCCGGAACTGGAAGCAACTCGACGCCTTGGTG
GCACATCGCGATAAAACATTGCGCAAGCTGGAGGCTACCTGGGCCCAGTACTTGAAGCAACAGCAGTCCGTCACC
AAGCAGCACAACCACTTTACGCAGACAGCGAATACGGGCCTCTTGAACGACGAGGAGCAGCCCGACAGCAGCAGC
CGCCTCCTCGCTAGCAACCCGAACCAGCCGCATGTCGTCGAGGGCGAGCGACCCTGGATCAATATCTGGTATGGA
CCTCTCTCCATGCGGAGGCGCAGGGTCGATGCCCTGGACTACTACCAGGAGCGGCTTCGCCGGCTGGACGAGAGG
GTCGCCGAGGCTCGCGGCAAGGAGTACGAGGCCACCGACATGGCCTTGGTCACCATGGACTCGGTCGCGTCATGC
CAGATGGTGGTTCAAGCCAGGATAGACCCACGGCCCGGCTGTTTCCTGACCAAGCTGTCCCCGTCGCCGGCAGAC
CTGGTGTGGAGAAACACGTACTCTCCGCGCGGCATTCGGAGACTCAAGTCGTGGGGCATCACCATCTTCATCACT
GTCTTGACGCTACTCTGGATCTTTCCCACGGCCCTTCTCGCGTCGTGGCTCAGCGTCTGCACGATCAAAGCAGTG
CTACCCTCATTTTCAAAATGGTTATCACGCCACCCCATCATCTACTCGCTCTTTCAAAACGGGGTACCCACGCTC
GTCGTATCGCTGCTCAACGTGGCCGTGCCGTACCTGTACGACTGGCTCTCCAATCATCAGGGCATGATGTCTCAG
GGCGACGTCGAGTTGTCGGTGATATCCAAGAACTTTTTCTTCACCTTCTTCAATACCTTTTTCGTCTTCGCCGTC
TCGCGCACCGGCTTTGACTTTTGGAGCGTGTTGCAGAAGCTACTCAAGGACACCAGCAAGATCCCGGCTGCCATC
GCGGCTGACGTCGAGGACCTGTCCATCTTCTACATCAACTTCATCATGCTCCAGGGCGTCGGTCTGATGCCGTTT
CGTATTCTGGAGGTCGGTAGCGTGTTCCTCTATCCCATCTACCGATTCATGTCATCGACGCCCCGGGACTATGCC
GAGTTACAGAAGCCGCCGGTGTTTCAATACGGCTTCTACCTGCCGACGGCGCTGCTCGTTTTCAACCTGTGCCTG
ATCTACAGCGTGCTGATGTGGGGCTTCGCCATCCTCGTCTTTGGGACCGTTTATTTCCTGCTCGGACATCTCACC
TTCAAGTACATGGTGCTGTATGCTATGGATCAGCCCCAGCACGCGACGGGCGGCGCGTGGCGCATAATATGCCAC
CGTATCGTCATCGGCCTCGTCGTGTTTGAGGTGGTCATGATCGGGCAGATTGCGTCGCTGGCGGCGTTCGTGCAG
TCAGTGGCGGTTCTGCCGCTCATCCCGTTTACTATTTGGTACAGCTACTACTTTAAGCGACGGTTCGAGCCCCTG
ACCAAGTACATTGCACTGCGAGCTATCGGCAGCGGGGGCAGTCAGTCGACCCAGGAGGGCTCGGGTGACGACCAC
GAGTCGCAGCCGTTGCGAGGGTTGATGAGGAGACAGAGCACGCTGGACGAGTATATGGAGAAGGACCTTGTCTTC
GTTAACCCAAGCCTCGTCACCTCGCTCTCGCAGCCCTGGATATACAAAGACCCGCCTCAACCGTTGTCGTCTGGC
GAGGGGGCAGCCGGGGCAGAGCCAGAGCGGTCTTCCCCGGCGCGGCCGGCGTTGATCTTGCCTGATGCGGACCGG
TCTCTTGGCATCGGGGACGACAACGTATGGGCCGACAGCAGCCGGGGAGAAAGGAGG
Transcript >Ophio5|21
ATGCTTCAGGGCACCCAGAACGAGACATGCAACCCGGAAGACTACGTCAAGCCGCCGTCCAAGAACCAAAAGGAC
CTCGAGGTTCAGCTCATTCTCTCCCTGATCCTCGGCGTCTCAGCGCTCGTCGCCTTCTGCATATTGCGCCCCCGA
TGGCCTGCTCTCTATTCTGCCCGCAAGCGTCGTCTCGACGCAGACATGGCTCCTCCCGCCCTCTCCAACTCGTGC
TTCGGCTGGGTCCCTCACCTACTTAGAGTTACGGATGAGCAAGTTCTGGCTTCCGCTGGGCTCGATGCCTTTGTC
TTTTTGGCTTTCTTCAAGATGGCGACGCGGCTTTTCATGACCATGTCCTTTTTCGCCGTCGTCGTCCTCTGGCCC
ATCAACTCCCATTACCGCGACTTTCAAGTCGGCCTCGGCGAAGGCCGTAACCCTGTTGGCAACAGCAGCGCCGCA
GCCTACTACCACGACCTGTACGGCCCTATTCGACCTCCCCTCTACCGCCAGTCAGCCGCTCTCGATGCACTCCCC
GGAACTGGCGAAGACAAGAGTCGCGTCCGCACCTACCTGTGGGCATACGTTGTCTTCACCTACTTCTTCGTCGGC
CTGACTCTCTACGCCATCAACCGGGAGACTTTTCGCATCATCCGCCTGAGGCAAAAATATCTCGGATCGCAGTCC
ACCATTACCGATCGCACATTCCGTCTGACGGGTATACCGCTTGAGTATCGATCTGATCAGAAACTCAAGGATATG
ATTGAGGGACTCGGCATTGGCCTCGTTGACTCCGTTACGCTGTGCCGGAACTGGAAGCAACTCGACGCCTTGGTG
GCACATCGCGATAAAACATTGCGCAAGCTGGAGGCTACCTGGGCCCAGTACTTGAAGCAACAGCAGTCCGTCACC
AAGCAGCACAACCACTTTACGCAGACAGCGAATACGGGCCTCTTGAACGACGAGGAGCAGCCCGACAGCAGCAGC
CGCCTCCTCGCTAGCAACCCGAACCAGCCGCATGTCGTCGAGGGCGAGCGACCCTGGATCAATATCTGGTATGGA
CCTCTCTCCATGCGGAGGCGCAGGGTCGATGCCCTGGACTACTACCAGGAGCGGCTTCGCCGGCTGGACGAGAGG
GTCGCCGAGGCTCGCGGCAAGGAGTACGAGGCCACCGACATGGCCTTGGTCACCATGGACTCGGTCGCGTCATGC
CAGATGGTGGTTCAAGCCAGGATAGACCCACGGCCCGGCTGTTTCCTGACCAAGCTGTCCCCGTCGCCGGCAGAC
CTGGTGTGGAGAAACACGTACTCTCCGCGCGGCATTCGGAGACTCAAGTCGTGGGGCATCACCATCTTCATCACT
GTCTTGACGCTACTCTGGATCTTTCCCACGGCCCTTCTCGCGTCGTGGCTCAGCGTCTGCACGATCAAAGCAGTG
CTACCCTCATTTTCAAAATGGTTATCACGCCACCCCATCATCTACTCGCTCTTTCAAAACGGGGTACCCACGCTC
GTCGTATCGCTGCTCAACGTGGCCGTGCCGTACCTGTACGACTGGCTCTCCAATCATCAGGGCATGATGTCTCAG
GGCGACGTCGAGTTGTCGGTGATATCCAAGAACTTTTTCTTCACCTTCTTCAATACCTTTTTCGTCTTCGCCGTC
TCGCGCACCGGCTTTGACTTTTGGAGCGTGTTGCAGAAGCTACTCAAGGACACCAGCAAGATCCCGGCTGCCATC
GCGGCTGACGTCGAGGACCTGTCCATCTTCTACATCAACTTCATCATGCTCCAGGGCGTCGGTCTGATGCCGTTT
CGTATTCTGGAGGTCGGTAGCGTGTTCCTCTATCCCATCTACCGATTCATGTCATCGACGCCCCGGGACTATGCC
GAGTTACAGAAGCCGCCGGTGTTTCAATACGGCTTCTACCTGCCGACGGCGCTGCTCGTTTTCAACCTGTGCCTG
ATCTACAGCGTGCTGATGTGGGGCTTCGCCATCCTCGTCTTTGGGACCGTTTATTTCCTGCTCGGACATCTCACC
TTCAAGTACATGGTGCTGTATGCTATGGATCAGCCCCAGCACGCGACGGGCGGCGCGTGGCGCATAATATGCCAC
CGTATCGTCATCGGCCTCGTCGTGTTTGAGGTGGTCATGATCGGGCAGATTGCGTCGCTGGCGGCGTTCGTGCAG
TCAGTGGCGGTTCTGCCGCTCATCCCGTTTACTATTTGGTACAGCTACTACTTTAAGCGACGGTTCGAGCCCCTG
ACCAAGTACATTGCACTGCGAGCTATCGGCAGCGGGGGCAGTCAGTCGACCCAGGAGGGCTCGGGTGACGACCAC
GAGTCGCAGCCGTTGCGAGGGTTGATGAGGAGACAGAGCACGCTGGACGAGTATATGGAGAAGGACCTTGTCTTC
GTTAACCCAAGCCTCGTCACCTCGCTCTCGCAGCCCTGGATATACAAAGACCCGCCTCAACCGTTGTCGTCTGGC
GAGGGGGCAGCCGGGGCAGAGCCAGAGCGGTCTTCCCCGGCGCGGCCGGCGTTGATCTTGCCTGATGCGGACCGG
TCTCTTGGCATCGGGGACGACAACGTATGGGCCGACAGCAGCCGGGGAGAAAGGAGGTAG
Gene >Ophio5|21
ATGCTTCAGGGCACCCAGAACGAGACATGCAACCCGGAAGACTACGTCAAGCCGCCGTCCAAGAACCAAAAGGAC
CTCGAGGTTCAGCTCATTCTCTCCCTGATCCTCGGCGTCTCAGCGCTCGTCGCCTTCTGCGTGAGTTGATGGCCT
CGTCTTGAGACCGTTCACCGTACTGAATCCGCGTTCCCTCCCCGCCAGATATTGCGCCCCCGATGGCCTGCTCTC
TATTCTGCCCGCAAGCGTCGTCTCGACGCAGACATGGCTCCTCCCGCCCTCTCCAACTCGTGCTTCGGCTGGGTC
CCTCACCTACTTAGAGTTACGGATGAGCAAGTTCTGGCTTCCGCTGGGCTCGATGCCTTTGTCGTATGTCGCGCT
GTGGATGCCTGAGCCGACACCACGAGTCGCTGACATGCCGTCTCTAGTTTTTGGCTTTCTTCAAGATGGCGACGC
GGCTTTTCATGACCATGTCCTTTTTCGCCGTCGTCGTCCTCTGGCCCATCAACTCCCATTACCGCGACTTTCAAG
TCGGCCTCGGCGAAGGCCGTAACCCTGTTGGCAACAGCAGCGCCGCAGCCTACTACCACGACCTGTACGGCCCTA
TTCGACCTCCCCTCTACCGCCAGTCAGCCGCTCTCGATGCACTCCCCGGAACTGGCGAAGACAAGAGTCGCGTCC
GCACCTACCTGTGGGCATACGTTGTCTTCACCTACTTCTTCGTCGGCCTGACTCTCTACGCCATCAACCGGGAGA
CTTTTCGCATCATCCGCCTGAGGCAAAAATATCTCGGATCGCAGTCCACCATTACCGATCGCACATTCCGTCTGA
CGGGTATACCGCTTGAGTATCGATCTGATCAGAAACTCAAGGATATGATTGAGGGACTCGGCATTGGCCTCGTTG
ACTCCGTTACGCTGTGCCGGAACTGGAAGCAACTCGACGCCTTGGTGGCACATCGCGATAAAACATTGCGCAAGC
TGGAGGCTACCTGGGCCCAGTACTTGAAGCAACAGCAGTCCGTCACCAAGCAGCACAACCACTTTACGCAGACAG
CGAATACGGGCCTCTTGAACGACGAGGAGCAGCCCGACAGCAGCAGCCGCCTCCTCGCTAGCAACCCGAACCAGC
CGCATGTCGTCGAGGGCGAGCGACCCTGGATCAATATCTGGTATGGACCTCTCTCCATGCGGAGGCGCAGGGTCG
ATGCCCTGGACTACTACCAGGAGCGGCTTCGCCGGCTGGACGAGAGGGTCGCCGAGGCTCGCGGCAAGGAGTACG
AGGCCACCGACATGGCCTTGGTCACCATGGACTCGGTCGCGTCATGCCAGATGGTGGTTCAAGCCAGGATAGACC
CACGGCCCGGCTGTTTCCTGACCAAGCTGTCCCCGTCGCCGGCAGACCTGGTGTGGAGAAACACGTACTCTCCGC
GCGGCATTCGGAGACTCAAGTCGTGGGGCATCACCATCTTCATCACTGTCTTGACGCTACTCTGGATCTTTCCCA
CGGCCCTTCTCGCGTCGTGGCTCAGCGTCTGCACGATCAAAGCAGTGCTACCCTCATTTTCAAAATGGTTATCAC
GCCACCCCATCATCTACTCGCTCTTTCAAAACGGGGTACCCACGCTCGTCGTATCGCTGCTCAACGTGGCCGTGC
CGTACCTGTACGACTGGCTCTCCAATCATCAGGGCATGATGTCTCAGGGCGACGTCGAGTTGTCGGTGATATCCA
AGAACTTTTTCTTCACCTTCTTCAATACCTTTTTCGTCTTCGCCGTCTCGCGCACCGGCTTTGACTTTTGGAGCG
TGTTGCAGAAGCTACTCAAGGACACCAGCAAGATCCCGGCTGCCATCGCGGCTGACGTCGAGGACCTGTCCATCT
TCTACATCAACTTCATCATGCTCCAGGGCGTCGGTCTGATGCCGTTTCGTATTCTGGAGGTCGGTAGCGTGTTCC
TCTATCCCATCTACCGATTCATGTCATCGACGCCCCGGGACTATGCCGAGTTACAGAAGCCGCCGGTGTTTCAAT
ACGGCTTCTACCTGCCGACGGCGCTGCTCGTTTTCAACCTGTGCCTGATCTACAGCGTGCTGATGTGGGGCTTCG
CCATCCTCGTCTTTGGGACCGTTTATTTCCTGCTCGGACATCTCACCTTCAAGTACATGGTGCTGTATGCTATGG
ATCAGCCCCAGCACGCGACGGGCGGCGCGTGGCGCATAATATGCCACCGTATCGTCATCGGCCTCGTCGTGTTTG
AGGTGGTCATGATCGGGCAGATTGCGTCGCTGGCGGCGTTCGTGCAGTCAGTGGCGGTTCTGCCGCTCATCCCGT
TTACTATTTGGTACAGCTACTACTTTAAGCGACGGTTCGAGCCCCTGACCAAGTACATTGCACTGCGAGCTATCG
GCAGCGGGGGCAGTCAGTCGACCCAGGAGGGCTCGGGTGACGACCACGAGTCGCAGCCGTTGCGAGGGTTGATGA
GGAGACAGAGCACGCTGGACGAGTATATGGAGAAGGACCTTGTCTTCGTTAACCCAAGCCTCGTCACCTCGTAAG
CTCGACCTCGTTGTGATTCTACGACCGGAGACTGACTGGATGCAGGCTCTCGCAGCCCTGGATATACAAAGACCC
GCCTCAACCGTTGTCGTCTGGCGAGGGGGCAGCCGGGGCAGAGCCAGAGCGGTCTTCCCCGGCGCGGCCGGCGTT
GATCTTGCCTGATGCGGACCGGTCTCTTGGCATCGGGGACGACAACGTATGGGCCGACAGCAGCCGGGGAGAAAG
GAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail