Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|21
Gene name
Locationscaffold_1:43789..46571
Strand-
Gene length (bp)2782
Transcript length (bp)2610
Coding sequence length (bp)2607
Protein length (aa) 869

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 6.3E-73 441 715
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.3E-36 28 209
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.9E-34 229 430

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 13 777 5.0E-157
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 19 766 5.0E-118
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 25 749 3.0E-32
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 28 754 2.0E-31
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 76 750 4.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 13 777 5.0E-157
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 19 766 5.0E-118
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 25 749 3.0E-32
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 28 754 2.0E-31
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 76 750 4.0E-31
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 76 748 2.0E-28
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 78 749 3.0E-27
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 77 748 4.0E-26
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 350 749 1.0E-25
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 77 749 2.0E-25
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 77 749 2.0E-25
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 366 817 1.0E-24
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 35 754 2.0E-24
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 350 786 2.0E-22
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 327 749 5.0E-22
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 357 747 1.0E-21
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 30 761 2.0E-21
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 351 750 9.0E-19
sp|Q91YT8|CSCL1_MOUSE CSC1-like protein 1 OS=Mus musculus GN=Tmem63a PE=1 SV=1 75 683 5.0E-16
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 185 759 1.0E-15
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 75 682 4.0E-15
sp|O94886|CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens GN=TMEM63A PE=1 SV=3 75 682 2.0E-14
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 419 737 7.0E-13
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 389 750 2.0E-10
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 411 750 3.0E-10
sp|Q5T3F8|CSCL2_HUMAN CSC1-like protein 2 OS=Homo sapiens GN=TMEM63B PE=1 SV=1 188 733 2.0E-07
sp|Q3TWI9|CSCL2_MOUSE CSC1-like protein 2 OS=Mus musculus GN=Tmem63b PE=1 SV=1 188 733 1.0E-06
sp|Q9P1W3|CSC1_HUMAN Calcium permeable stress-gated cation channel 1 OS=Homo sapiens GN=TMEM63C PE=2 SV=1 357 733 2.0E-06
sp|Q8CBX0|CSC1_MOUSE Calcium permeable stress-gated cation channel 1 OS=Mus musculus GN=Tmem63c PE=1 SV=1 357 733 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 107 126 19
3 185 207 22
4 445 467 22
5 487 509 22
6 530 552 22
7 589 611 22
8 632 654 22
9 659 681 22
10 694 716 22
11 721 743 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|21
MLQGTQNETCNPEDYVKPPSKNQKDLEVQLILSLILGVSALVAFCILRPRWPALYSARKRRLDADMAPPALSNSC
FGWVPHLLRVTDEQVLASAGLDAFVFLAFFKMATRLFMTMSFFAVVVLWPINSHYRDFQVGLGEGRNPVGNSSAA
AYYHDLYGPIRPPLYRQSAALDALPGTGEDKSRVRTYLWAYVVFTYFFVGLTLYAINRETFRIIRLRQKYLGSQS
TITDRTFRLTGIPLEYRSDQKLKDMIEGLGIGLVDSVTLCRNWKQLDALVAHRDKTLRKLEATWAQYLKQQQSVT
KQHNHFTQTANTGLLNDEEQPDSSSRLLASNPNQPHVVEGERPWINIWYGPLSMRRRRVDALDYYQERLRRLDER
VAEARGKEYEATDMALVTMDSVASCQMVVQARIDPRPGCFLTKLSPSPADLVWRNTYSPRGIRRLKSWGITIFIT
VLTLLWIFPTALLASWLSVCTIKAVLPSFSKWLSRHPIIYSLFQNGVPTLVVSLLNVAVPYLYDWLSNHQGMMSQ
GDVELSVISKNFFFTFFNTFFVFAVSRTGFDFWSVLQKLLKDTSKIPAAIAADVEDLSIFYINFIMLQGVGLMPF
RILEVGSVFLYPIYRFMSSTPRDYAELQKPPVFQYGFYLPTALLVFNLCLIYSVLMWGFAILVFGTVYFLLGHLT
FKYMVLYAMDQPQHATGGAWRIICHRIVIGLVVFEVVMIGQIASLAAFVQSVAVLPLIPFTIWYSYYFKRRFEPL
TKYIALRAIGSGGSQSTQEGSGDDHESQPLRGLMRRQSTLDEYMEKDLVFVNPSLVTSLSQPWIYKDPPQPLSSG
EGAAGAEPERSSPARPALILPDADRSLGIGDDNVWADSSRGERR
Coding >Ophio5|21
ATGCTTCAGGGCACCCAGAACGAGACATGCAACCCGGAAGACTACGTCAAGCCGCCGTCCAAGAACCAAAAGGAC
CTCGAGGTTCAGCTCATTCTCTCCCTGATCCTCGGCGTCTCAGCGCTCGTCGCCTTCTGCATATTGCGCCCCCGA
TGGCCTGCTCTCTATTCTGCCCGCAAGCGTCGTCTCGACGCAGACATGGCTCCTCCCGCCCTCTCCAACTCGTGC
TTCGGCTGGGTCCCTCACCTACTTAGAGTTACGGATGAGCAAGTTCTGGCTTCCGCTGGGCTCGATGCCTTTGTC
TTTTTGGCTTTCTTCAAGATGGCGACGCGGCTTTTCATGACCATGTCCTTTTTCGCCGTCGTCGTCCTCTGGCCC
ATCAACTCCCATTACCGCGACTTTCAAGTCGGCCTCGGCGAAGGCCGTAACCCTGTTGGCAACAGCAGCGCCGCA
GCCTACTACCACGACCTGTACGGCCCTATTCGACCTCCCCTCTACCGCCAGTCAGCCGCTCTCGATGCACTCCCC
GGAACTGGCGAAGACAAGAGTCGCGTCCGCACCTACCTGTGGGCATACGTTGTCTTCACCTACTTCTTCGTCGGC
CTGACTCTCTACGCCATCAACCGGGAGACTTTTCGCATCATCCGCCTGAGGCAAAAATATCTCGGATCGCAGTCC
ACCATTACCGATCGCACATTCCGTCTGACGGGTATACCGCTTGAGTATCGATCTGATCAGAAACTCAAGGATATG
ATTGAGGGACTCGGCATTGGCCTCGTTGACTCCGTTACGCTGTGCCGGAACTGGAAGCAACTCGACGCCTTGGTG
GCACATCGCGATAAAACATTGCGCAAGCTGGAGGCTACCTGGGCCCAGTACTTGAAGCAACAGCAGTCCGTCACC
AAGCAGCACAACCACTTTACGCAGACAGCGAATACGGGCCTCTTGAACGACGAGGAGCAGCCCGACAGCAGCAGC
CGCCTCCTCGCTAGCAACCCGAACCAGCCGCATGTCGTCGAGGGCGAGCGACCCTGGATCAATATCTGGTATGGA
CCTCTCTCCATGCGGAGGCGCAGGGTCGATGCCCTGGACTACTACCAGGAGCGGCTTCGCCGGCTGGACGAGAGG
GTCGCCGAGGCTCGCGGCAAGGAGTACGAGGCCACCGACATGGCCTTGGTCACCATGGACTCGGTCGCGTCATGC
CAGATGGTGGTTCAAGCCAGGATAGACCCACGGCCCGGCTGTTTCCTGACCAAGCTGTCCCCGTCGCCGGCAGAC
CTGGTGTGGAGAAACACGTACTCTCCGCGCGGCATTCGGAGACTCAAGTCGTGGGGCATCACCATCTTCATCACT
GTCTTGACGCTACTCTGGATCTTTCCCACGGCCCTTCTCGCGTCGTGGCTCAGCGTCTGCACGATCAAAGCAGTG
CTACCCTCATTTTCAAAATGGTTATCACGCCACCCCATCATCTACTCGCTCTTTCAAAACGGGGTACCCACGCTC
GTCGTATCGCTGCTCAACGTGGCCGTGCCGTACCTGTACGACTGGCTCTCCAATCATCAGGGCATGATGTCTCAG
GGCGACGTCGAGTTGTCGGTGATATCCAAGAACTTTTTCTTCACCTTCTTCAATACCTTTTTCGTCTTCGCCGTC
TCGCGCACCGGCTTTGACTTTTGGAGCGTGTTGCAGAAGCTACTCAAGGACACCAGCAAGATCCCGGCTGCCATC
GCGGCTGACGTCGAGGACCTGTCCATCTTCTACATCAACTTCATCATGCTCCAGGGCGTCGGTCTGATGCCGTTT
CGTATTCTGGAGGTCGGTAGCGTGTTCCTCTATCCCATCTACCGATTCATGTCATCGACGCCCCGGGACTATGCC
GAGTTACAGAAGCCGCCGGTGTTTCAATACGGCTTCTACCTGCCGACGGCGCTGCTCGTTTTCAACCTGTGCCTG
ATCTACAGCGTGCTGATGTGGGGCTTCGCCATCCTCGTCTTTGGGACCGTTTATTTCCTGCTCGGACATCTCACC
TTCAAGTACATGGTGCTGTATGCTATGGATCAGCCCCAGCACGCGACGGGCGGCGCGTGGCGCATAATATGCCAC
CGTATCGTCATCGGCCTCGTCGTGTTTGAGGTGGTCATGATCGGGCAGATTGCGTCGCTGGCGGCGTTCGTGCAG
TCAGTGGCGGTTCTGCCGCTCATCCCGTTTACTATTTGGTACAGCTACTACTTTAAGCGACGGTTCGAGCCCCTG
ACCAAGTACATTGCACTGCGAGCTATCGGCAGCGGGGGCAGTCAGTCGACCCAGGAGGGCTCGGGTGACGACCAC
GAGTCGCAGCCGTTGCGAGGGTTGATGAGGAGACAGAGCACGCTGGACGAGTATATGGAGAAGGACCTTGTCTTC
GTTAACCCAAGCCTCGTCACCTCGCTCTCGCAGCCCTGGATATACAAAGACCCGCCTCAACCGTTGTCGTCTGGC
GAGGGGGCAGCCGGGGCAGAGCCAGAGCGGTCTTCCCCGGCGCGGCCGGCGTTGATCTTGCCTGATGCGGACCGG
TCTCTTGGCATCGGGGACGACAACGTATGGGCCGACAGCAGCCGGGGAGAAAGGAGG
Transcript >Ophio5|21
ATGCTTCAGGGCACCCAGAACGAGACATGCAACCCGGAAGACTACGTCAAGCCGCCGTCCAAGAACCAAAAGGAC
CTCGAGGTTCAGCTCATTCTCTCCCTGATCCTCGGCGTCTCAGCGCTCGTCGCCTTCTGCATATTGCGCCCCCGA
TGGCCTGCTCTCTATTCTGCCCGCAAGCGTCGTCTCGACGCAGACATGGCTCCTCCCGCCCTCTCCAACTCGTGC
TTCGGCTGGGTCCCTCACCTACTTAGAGTTACGGATGAGCAAGTTCTGGCTTCCGCTGGGCTCGATGCCTTTGTC
TTTTTGGCTTTCTTCAAGATGGCGACGCGGCTTTTCATGACCATGTCCTTTTTCGCCGTCGTCGTCCTCTGGCCC
ATCAACTCCCATTACCGCGACTTTCAAGTCGGCCTCGGCGAAGGCCGTAACCCTGTTGGCAACAGCAGCGCCGCA
GCCTACTACCACGACCTGTACGGCCCTATTCGACCTCCCCTCTACCGCCAGTCAGCCGCTCTCGATGCACTCCCC
GGAACTGGCGAAGACAAGAGTCGCGTCCGCACCTACCTGTGGGCATACGTTGTCTTCACCTACTTCTTCGTCGGC
CTGACTCTCTACGCCATCAACCGGGAGACTTTTCGCATCATCCGCCTGAGGCAAAAATATCTCGGATCGCAGTCC
ACCATTACCGATCGCACATTCCGTCTGACGGGTATACCGCTTGAGTATCGATCTGATCAGAAACTCAAGGATATG
ATTGAGGGACTCGGCATTGGCCTCGTTGACTCCGTTACGCTGTGCCGGAACTGGAAGCAACTCGACGCCTTGGTG
GCACATCGCGATAAAACATTGCGCAAGCTGGAGGCTACCTGGGCCCAGTACTTGAAGCAACAGCAGTCCGTCACC
AAGCAGCACAACCACTTTACGCAGACAGCGAATACGGGCCTCTTGAACGACGAGGAGCAGCCCGACAGCAGCAGC
CGCCTCCTCGCTAGCAACCCGAACCAGCCGCATGTCGTCGAGGGCGAGCGACCCTGGATCAATATCTGGTATGGA
CCTCTCTCCATGCGGAGGCGCAGGGTCGATGCCCTGGACTACTACCAGGAGCGGCTTCGCCGGCTGGACGAGAGG
GTCGCCGAGGCTCGCGGCAAGGAGTACGAGGCCACCGACATGGCCTTGGTCACCATGGACTCGGTCGCGTCATGC
CAGATGGTGGTTCAAGCCAGGATAGACCCACGGCCCGGCTGTTTCCTGACCAAGCTGTCCCCGTCGCCGGCAGAC
CTGGTGTGGAGAAACACGTACTCTCCGCGCGGCATTCGGAGACTCAAGTCGTGGGGCATCACCATCTTCATCACT
GTCTTGACGCTACTCTGGATCTTTCCCACGGCCCTTCTCGCGTCGTGGCTCAGCGTCTGCACGATCAAAGCAGTG
CTACCCTCATTTTCAAAATGGTTATCACGCCACCCCATCATCTACTCGCTCTTTCAAAACGGGGTACCCACGCTC
GTCGTATCGCTGCTCAACGTGGCCGTGCCGTACCTGTACGACTGGCTCTCCAATCATCAGGGCATGATGTCTCAG
GGCGACGTCGAGTTGTCGGTGATATCCAAGAACTTTTTCTTCACCTTCTTCAATACCTTTTTCGTCTTCGCCGTC
TCGCGCACCGGCTTTGACTTTTGGAGCGTGTTGCAGAAGCTACTCAAGGACACCAGCAAGATCCCGGCTGCCATC
GCGGCTGACGTCGAGGACCTGTCCATCTTCTACATCAACTTCATCATGCTCCAGGGCGTCGGTCTGATGCCGTTT
CGTATTCTGGAGGTCGGTAGCGTGTTCCTCTATCCCATCTACCGATTCATGTCATCGACGCCCCGGGACTATGCC
GAGTTACAGAAGCCGCCGGTGTTTCAATACGGCTTCTACCTGCCGACGGCGCTGCTCGTTTTCAACCTGTGCCTG
ATCTACAGCGTGCTGATGTGGGGCTTCGCCATCCTCGTCTTTGGGACCGTTTATTTCCTGCTCGGACATCTCACC
TTCAAGTACATGGTGCTGTATGCTATGGATCAGCCCCAGCACGCGACGGGCGGCGCGTGGCGCATAATATGCCAC
CGTATCGTCATCGGCCTCGTCGTGTTTGAGGTGGTCATGATCGGGCAGATTGCGTCGCTGGCGGCGTTCGTGCAG
TCAGTGGCGGTTCTGCCGCTCATCCCGTTTACTATTTGGTACAGCTACTACTTTAAGCGACGGTTCGAGCCCCTG
ACCAAGTACATTGCACTGCGAGCTATCGGCAGCGGGGGCAGTCAGTCGACCCAGGAGGGCTCGGGTGACGACCAC
GAGTCGCAGCCGTTGCGAGGGTTGATGAGGAGACAGAGCACGCTGGACGAGTATATGGAGAAGGACCTTGTCTTC
GTTAACCCAAGCCTCGTCACCTCGCTCTCGCAGCCCTGGATATACAAAGACCCGCCTCAACCGTTGTCGTCTGGC
GAGGGGGCAGCCGGGGCAGAGCCAGAGCGGTCTTCCCCGGCGCGGCCGGCGTTGATCTTGCCTGATGCGGACCGG
TCTCTTGGCATCGGGGACGACAACGTATGGGCCGACAGCAGCCGGGGAGAAAGGAGGTAG
Gene >Ophio5|21
ATGCTTCAGGGCACCCAGAACGAGACATGCAACCCGGAAGACTACGTCAAGCCGCCGTCCAAGAACCAAAAGGAC
CTCGAGGTTCAGCTCATTCTCTCCCTGATCCTCGGCGTCTCAGCGCTCGTCGCCTTCTGCGTGAGTTGATGGCCT
CGTCTTGAGACCGTTCACCGTACTGAATCCGCGTTCCCTCCCCGCCAGATATTGCGCCCCCGATGGCCTGCTCTC
TATTCTGCCCGCAAGCGTCGTCTCGACGCAGACATGGCTCCTCCCGCCCTCTCCAACTCGTGCTTCGGCTGGGTC
CCTCACCTACTTAGAGTTACGGATGAGCAAGTTCTGGCTTCCGCTGGGCTCGATGCCTTTGTCGTATGTCGCGCT
GTGGATGCCTGAGCCGACACCACGAGTCGCTGACATGCCGTCTCTAGTTTTTGGCTTTCTTCAAGATGGCGACGC
GGCTTTTCATGACCATGTCCTTTTTCGCCGTCGTCGTCCTCTGGCCCATCAACTCCCATTACCGCGACTTTCAAG
TCGGCCTCGGCGAAGGCCGTAACCCTGTTGGCAACAGCAGCGCCGCAGCCTACTACCACGACCTGTACGGCCCTA
TTCGACCTCCCCTCTACCGCCAGTCAGCCGCTCTCGATGCACTCCCCGGAACTGGCGAAGACAAGAGTCGCGTCC
GCACCTACCTGTGGGCATACGTTGTCTTCACCTACTTCTTCGTCGGCCTGACTCTCTACGCCATCAACCGGGAGA
CTTTTCGCATCATCCGCCTGAGGCAAAAATATCTCGGATCGCAGTCCACCATTACCGATCGCACATTCCGTCTGA
CGGGTATACCGCTTGAGTATCGATCTGATCAGAAACTCAAGGATATGATTGAGGGACTCGGCATTGGCCTCGTTG
ACTCCGTTACGCTGTGCCGGAACTGGAAGCAACTCGACGCCTTGGTGGCACATCGCGATAAAACATTGCGCAAGC
TGGAGGCTACCTGGGCCCAGTACTTGAAGCAACAGCAGTCCGTCACCAAGCAGCACAACCACTTTACGCAGACAG
CGAATACGGGCCTCTTGAACGACGAGGAGCAGCCCGACAGCAGCAGCCGCCTCCTCGCTAGCAACCCGAACCAGC
CGCATGTCGTCGAGGGCGAGCGACCCTGGATCAATATCTGGTATGGACCTCTCTCCATGCGGAGGCGCAGGGTCG
ATGCCCTGGACTACTACCAGGAGCGGCTTCGCCGGCTGGACGAGAGGGTCGCCGAGGCTCGCGGCAAGGAGTACG
AGGCCACCGACATGGCCTTGGTCACCATGGACTCGGTCGCGTCATGCCAGATGGTGGTTCAAGCCAGGATAGACC
CACGGCCCGGCTGTTTCCTGACCAAGCTGTCCCCGTCGCCGGCAGACCTGGTGTGGAGAAACACGTACTCTCCGC
GCGGCATTCGGAGACTCAAGTCGTGGGGCATCACCATCTTCATCACTGTCTTGACGCTACTCTGGATCTTTCCCA
CGGCCCTTCTCGCGTCGTGGCTCAGCGTCTGCACGATCAAAGCAGTGCTACCCTCATTTTCAAAATGGTTATCAC
GCCACCCCATCATCTACTCGCTCTTTCAAAACGGGGTACCCACGCTCGTCGTATCGCTGCTCAACGTGGCCGTGC
CGTACCTGTACGACTGGCTCTCCAATCATCAGGGCATGATGTCTCAGGGCGACGTCGAGTTGTCGGTGATATCCA
AGAACTTTTTCTTCACCTTCTTCAATACCTTTTTCGTCTTCGCCGTCTCGCGCACCGGCTTTGACTTTTGGAGCG
TGTTGCAGAAGCTACTCAAGGACACCAGCAAGATCCCGGCTGCCATCGCGGCTGACGTCGAGGACCTGTCCATCT
TCTACATCAACTTCATCATGCTCCAGGGCGTCGGTCTGATGCCGTTTCGTATTCTGGAGGTCGGTAGCGTGTTCC
TCTATCCCATCTACCGATTCATGTCATCGACGCCCCGGGACTATGCCGAGTTACAGAAGCCGCCGGTGTTTCAAT
ACGGCTTCTACCTGCCGACGGCGCTGCTCGTTTTCAACCTGTGCCTGATCTACAGCGTGCTGATGTGGGGCTTCG
CCATCCTCGTCTTTGGGACCGTTTATTTCCTGCTCGGACATCTCACCTTCAAGTACATGGTGCTGTATGCTATGG
ATCAGCCCCAGCACGCGACGGGCGGCGCGTGGCGCATAATATGCCACCGTATCGTCATCGGCCTCGTCGTGTTTG
AGGTGGTCATGATCGGGCAGATTGCGTCGCTGGCGGCGTTCGTGCAGTCAGTGGCGGTTCTGCCGCTCATCCCGT
TTACTATTTGGTACAGCTACTACTTTAAGCGACGGTTCGAGCCCCTGACCAAGTACATTGCACTGCGAGCTATCG
GCAGCGGGGGCAGTCAGTCGACCCAGGAGGGCTCGGGTGACGACCACGAGTCGCAGCCGTTGCGAGGGTTGATGA
GGAGACAGAGCACGCTGGACGAGTATATGGAGAAGGACCTTGTCTTCGTTAACCCAAGCCTCGTCACCTCGTAAG
CTCGACCTCGTTGTGATTCTACGACCGGAGACTGACTGGATGCAGGCTCTCGCAGCCCTGGATATACAAAGACCC
GCCTCAACCGTTGTCGTCTGGCGAGGGGGCAGCCGGGGCAGAGCCAGAGCGGTCTTCCCCGGCGCGGCCGGCGTT
GATCTTGCCTGATGCGGACCGGTCTCTTGGCATCGGGGACGACAACGTATGGGCCGACAGCAGCCGGGGAGAAAG
GAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail