Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2097
Gene name
Locationscaffold_185:7763..8134
Strand-
Gene length (bp)371
Transcript length (bp)270
Coding sequence length (bp)267
Protein length (aa) 89

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09803 Pet100 Pet100 6.4E-20 1 77

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38958|PT100_YEAST Protein PET100, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET100 PE=1 SV=1 5 80 1.0E-14

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0033617 mitochondrial cytochrome c oxidase assembly Yes
GO:0043229 intracellular organelle No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0017004 cytochrome complex assembly No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008535 respiratory chain complex IV assembly No
GO:0043226 organelle No
GO:0043933 protein-containing complex organization No
GO:0005575 cellular_component No
GO:0016043 cellular component organization No
GO:0043227 membrane-bounded organelle No
GO:0071840 cellular component organization or biogenesis No
GO:0110165 cellular anatomical entity No
GO:0022607 cellular component assembly No
GO:0009987 cellular process No
GO:0033108 mitochondrial respiratory chain complex assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 318.76 156.66 480.86
CcL In ants, during behavior modification 210.96 91.42 330.49
CcD In ants, recently dead 245.56 114.91 376.22

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.121261 no
SC16a CcD 0.328058 no
CcL CcD 0.617475 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2097
MGGINLEIFKFGMYVMFPIGIMYYFGTNLDNRFAVPGFWPKPEECNKLPRDREEIEAEYHRIVARQRRRRALEEE
KQKKESQAVRGDDD
Coding >Ophio5|2097
ATGGGCGGCATCAACCTGGAAATCTTCAAGTTCGGCATGTACGTCATGTTCCCGATCGGCATCATGTATTACTTT
GGCACCAACCTCGACAACCGCTTCGCCGTGCCGGGCTTCTGGCCCAAGCCCGAAGAGTGCAACAAGTTACCCCGC
GACAGGGAAGAGATTGAGGCCGAATACCACCGCATCGTCGCGCGACAGCGGCGTCGTCGGGCGCTCGAGGAGGAG
AAGCAGAAGAAGGAGTCGCAAGCGGTGCGGGGAGACGATGAC
Transcript >Ophio5|2097
ATGGGCGGCATCAACCTGGAAATCTTCAAGTTCGGCATGTACGTCATGTTCCCGATCGGCATCATGTATTACTTT
GGCACCAACCTCGACAACCGCTTCGCCGTGCCGGGCTTCTGGCCCAAGCCCGAAGAGTGCAACAAGTTACCCCGC
GACAGGGAAGAGATTGAGGCCGAATACCACCGCATCGTCGCGCGACAGCGGCGTCGTCGGGCGCTCGAGGAGGAG
AAGCAGAAGAAGGAGTCGCAAGCGGTGCGGGGAGACGATGACTGA
Gene >Ophio5|2097
ATGGGCGGCATCAACCTGGAAATCTTCAAGGTAAAAATGACACACACACAACACACACACACACACACACACACA
CAAAAGAAAAGTCTGATAGCGCAGCGGGCCCGCGTTGGATGCGCTGATGCTTCCAGTTCGGCATGTACGTCATGT
TCCCGATCGGCATCATGTATTACTTTGGCACCAACCTCGACAACCGCTTCGCCGTGCCGGGCTTCTGGCCCAAGC
CCGAAGAGTGCAACAAGTTACCCCGCGACAGGGAAGAGATTGAGGCCGAATACCACCGCATCGTCGCGCGACAGC
GGCGTCGTCGGGCGCTCGAGGAGGAGAAGCAGAAGAAGGAGTCGCAAGCGGTGCGGGGAGACGATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail