Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2091
Gene name
Locationscaffold_184:21340..22132
Strand-
Gene length (bp)792
Transcript length (bp)792
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 2.8E-04 60 177

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016410 N-acyltransferase activity No
GO:0003674 molecular_function No
GO:0016407 acetyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2091
MDPDAPLVAMLEPCKLEGFRPGAPRHQQPASVPTLFVDAMDVRQRVFVQEQKVPVENEFDADDSRSCHWVVYSRF
DHHKHGGQEMLPVGTIRLVPFPHEPHPEVNGRYWNGVLEGPEETSAQVQMASGSPKVDRSTSFHDGKEPYVKLGR
LAVVREFRGKGLAGLLVGSALRWIMANPSFFDSTLSLQRADGLAEARPLDAPKWNGLVCAHAQQQAAGAWTKWGF
QVDEVMGNWWEEGIPHVGMFQRLQMEIDEARDSRLWPA
Coding >Ophio5|2091
ATGGACCCGGACGCCCCTTTGGTCGCCATGCTGGAGCCCTGCAAGCTCGAGGGGTTCCGACCGGGCGCCCCACGC
CATCAGCAGCCGGCCTCTGTTCCGACGCTGTTTGTCGACGCTATGGACGTCCGCCAGAGAGTCTTCGTCCAAGAG
CAAAAGGTGCCGGTCGAGAATGAGTTTGATGCTGACGACTCCCGTTCATGTCATTGGGTCGTCTATTCCAGGTTT
GATCACCACAAGCATGGCGGGCAAGAAATGTTACCTGTCGGGACGATACGACTCGTTCCCTTTCCCCACGAACCG
CACCCCGAAGTTAATGGCAGGTATTGGAACGGCGTTCTGGAGGGCCCAGAAGAGACGTCTGCCCAAGTGCAGATG
GCAAGCGGGTCTCCAAAGGTCGACCGTTCGACTTCCTTCCACGACGGCAAAGAGCCATACGTGAAGCTCGGCCGG
TTAGCTGTAGTGAGAGAATTTCGAGGCAAGGGTCTGGCGGGCCTTCTCGTCGGAAGCGCATTGCGTTGGATCATG
GCGAATCCGTCATTTTTCGATTCCACCCTTTCGTTACAACGCGCTGATGGGCTGGCCGAAGCAAGACCTCTGGAC
GCGCCTAAATGGAATGGTCTAGTCTGTGCCCACGCACAGCAGCAAGCCGCCGGCGCCTGGACAAAGTGGGGGTTC
CAGGTCGATGAGGTTATGGGTAATTGGTGGGAGGAGGGTATTCCTCACGTCGGCATGTTTCAACGGCTACAAATG
GAGATTGACGAAGCTCGTGATTCGCGTCTTTGGCCTGCT
Transcript >Ophio5|2091
ATGGACCCGGACGCCCCTTTGGTCGCCATGCTGGAGCCCTGCAAGCTCGAGGGGTTCCGACCGGGCGCCCCACGC
CATCAGCAGCCGGCCTCTGTTCCGACGCTGTTTGTCGACGCTATGGACGTCCGCCAGAGAGTCTTCGTCCAAGAG
CAAAAGGTGCCGGTCGAGAATGAGTTTGATGCTGACGACTCCCGTTCATGTCATTGGGTCGTCTATTCCAGGTTT
GATCACCACAAGCATGGCGGGCAAGAAATGTTACCTGTCGGGACGATACGACTCGTTCCCTTTCCCCACGAACCG
CACCCCGAAGTTAATGGCAGGTATTGGAACGGCGTTCTGGAGGGCCCAGAAGAGACGTCTGCCCAAGTGCAGATG
GCAAGCGGGTCTCCAAAGGTCGACCGTTCGACTTCCTTCCACGACGGCAAAGAGCCATACGTGAAGCTCGGCCGG
TTAGCTGTAGTGAGAGAATTTCGAGGCAAGGGTCTGGCGGGCCTTCTCGTCGGAAGCGCATTGCGTTGGATCATG
GCGAATCCGTCATTTTTCGATTCCACCCTTTCGTTACAACGCGCTGATGGGCTGGCCGAAGCAAGACCTCTGGAC
GCGCCTAAATGGAATGGTCTAGTCTGTGCCCACGCACAGCAGCAAGCCGCCGGCGCCTGGACAAAGTGGGGGTTC
CAGGTCGATGAGGTTATGGGTAATTGGTGGGAGGAGGGTATTCCTCACGTCGGCATGTTTCAACGGCTACAAATG
GAGATTGACGAAGCTCGTGATTCGCGTCTTTGGCCTGCTTAA
Gene >Ophio5|2091
ATGGACCCGGACGCCCCTTTGGTCGCCATGCTGGAGCCCTGCAAGCTCGAGGGGTTCCGACCGGGCGCCCCACGC
CATCAGCAGCCGGCCTCTGTTCCGACGCTGTTTGTCGACGCTATGGACGTCCGCCAGAGAGTCTTCGTCCAAGAG
CAAAAGGTGCCGGTCGAGAATGAGTTTGATGCTGACGACTCCCGTTCATGTCATTGGGTCGTCTATTCCAGGTTT
GATCACCACAAGCATGGCGGGCAAGAAATGTTACCTGTCGGGACGATACGACTCGTTCCCTTTCCCCACGAACCG
CACCCCGAAGTTAATGGCAGGTATTGGAACGGCGTTCTGGAGGGCCCAGAAGAGACGTCTGCCCAAGTGCAGATG
GCAAGCGGGTCTCCAAAGGTCGACCGTTCGACTTCCTTCCACGACGGCAAAGAGCCATACGTGAAGCTCGGCCGG
TTAGCTGTAGTGAGAGAATTTCGAGGCAAGGGTCTGGCGGGCCTTCTCGTCGGAAGCGCATTGCGTTGGATCATG
GCGAATCCGTCATTTTTCGATTCCACCCTTTCGTTACAACGCGCTGATGGGCTGGCCGAAGCAAGACCTCTGGAC
GCGCCTAAATGGAATGGTCTAGTCTGTGCCCACGCACAGCAGCAAGCCGCCGGCGCCTGGACAAAGTGGGGGTTC
CAGGTCGATGAGGTTATGGGTAATTGGTGGGAGGAGGGTATTCCTCACGTCGGCATGTTTCAACGGCTACAAATG
GAGATTGACGAAGCTCGTGATTCGCGTCTTTGGCCTGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail