Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2083
Gene name
Locationscaffold_184:7050..8737
Strand+
Gene length (bp)1687
Transcript length (bp)1434
Coding sequence length (bp)1431
Protein length (aa) 477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03900|YD132_YEAST Uncharacterized protein YDR132C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR132C PE=1 SV=1 25 264 8.0E-46
sp|Q12259|YL108_YEAST BTB/POZ domain-containing protein YLR108C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR108C PE=1 SV=1 25 265 6.0E-33

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4153 0.9115 0.2246 0.0332 0.1306 0.0009 0.0888 0.0198 0.0637 0.0102

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5065
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|45
Ophiocordyceps australis map64 (Brazil) OphauB2|1585
Ophiocordyceps camponoti-floridani Ophcf2|05746
Ophiocordyceps kimflemingae Ophio5|2083 (this protein)
Ophiocordyceps subramaniannii Hirsu2|286

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2083
MASTSPSDGHGSTPAGMRPPPVEVKMLPHGRLFPLQIGSELFKLSGASLCSDAPSYFTQYFLRQLVAAEQSAEEA
AIRILHVDRDPETFRDIALHLQGYPVSPRDGTHFVRLLTDAQFYSPVPKLTSQLFEGSIFVSIGHREFQLPRDLL
TSATNSPNFFSLGSATIFNRADGLNGDKRSAVLVPPSAPKRSADTFAELLRLLKGYAVRIRDETHREELLRDARY
FRFKGLEQQLIPHAISFNPIRRREEICLRLENVQKSGVSVAHEQQHGEGRTMVAWVNYARPYVDGRAAELVLEIG
GDATRIHWGGPDGPRADFFRDTKARVGRLFEVVATKLNLPLTTQPLGLLMASGGASSQPATPGNTPLSEDLVRVH
LSAESAVVLDGRPLVRPELDDDDDDDGGGGGGTNRARRKRRRVAPSTGFDEEVWFVRTGQWRLRIQGCRGGKSAV
ECVLVAVKLDAITSELGRNLARGFLGC
Coding >Ophio5|2083
ATGGCCTCGACGAGCCCCAGCGACGGCCATGGCTCGACGCCGGCCGGCATGAGGCCTCCGCCGGTAGAGGTCAAG
ATGCTACCGCATGGACGCCTGTTTCCCTTACAGATTGGGAGCGAGCTGTTTAAGCTGTCGGGCGCGTCTCTGTGT
TCTGACGCTCCCTCCTACTTTACCCAATACTTCCTCCGCCAGCTGGTCGCGGCCGAGCAAAGCGCAGAAGAGGCG
GCCATCCGCATACTCCACGTCGACCGCGACCCGGAGACGTTTCGCGATATCGCGCTGCATCTACAGGGCTACCCC
GTCAGCCCGAGGGACGGGACGCACTTTGTGCGGCTCTTGACCGATGCGCAGTTCTACAGCCCAGTCCCCAAGCTC
ACCTCGCAGCTCTTCGAGGGGAGCATCTTCGTCTCCATCGGGCATCGGGAGTTTCAGCTTCCGCGCGATCTCCTA
ACGAGCGCAACCAACTCGCCCAACTTCTTCTCTCTCGGCTCCGCCACCATCTTCAACCGTGCCGACGGCCTCAAC
GGTGACAAGCGTTCGGCCGTCCTGGTCCCGCCCTCGGCGCCGAAGCGGTCGGCCGATACGTTTGCCGAGTTGCTG
CGACTGCTGAAGGGATACGCCGTACGGATACGAGACGAGACGCACCGAGAGGAGCTGTTACGGGATGCGCGATAC
TTTCGCTTCAAGGGGCTCGAGCAGCAGCTCATACCGCACGCCATCAGCTTCAACCCGATTCGGAGGCGAGAAGAG
ATATGTCTGCGACTGGAGAATGTACAAAAGAGCGGCGTCAGCGTGGCGCATGAGCAGCAGCATGGCGAGGGGAGA
ACGATGGTGGCCTGGGTCAACTACGCGCGGCCCTACGTCGACGGCCGAGCGGCCGAACTGGTGCTCGAGATTGGT
GGCGACGCGACGCGCATTCACTGGGGGGGACCAGACGGGCCCAGGGCCGACTTCTTTCGCGACACAAAGGCCCGC
GTCGGCAGGCTATTCGAGGTGGTGGCCACCAAGCTGAATCTCCCCCTGACGACGCAGCCGCTGGGGCTCCTGATG
GCCTCGGGCGGCGCGAGCTCGCAGCCCGCTACGCCGGGGAACACGCCGCTGAGCGAGGACCTGGTGCGCGTCCAT
CTTTCGGCCGAGTCGGCTGTCGTGCTGGACGGGCGGCCGCTCGTACGGCCCGAGCTCGACGACGACGACGACGAC
GACGGCGGCGGCGGCGGCGGCACGAACCGGGCGAGGCGGAAGCGGAGACGCGTCGCGCCGTCGACGGGCTTTGAC
GAGGAGGTGTGGTTCGTCAGGACGGGCCAGTGGCGGTTGCGGATCCAGGGTTGTAGGGGCGGGAAGAGTGCCGTC
GAGTGCGTCCTCGTCGCGGTCAAGCTGGACGCTATCACGTCTGAGCTTGGTCGGAACCTGGCGCGGGGGTTTCTG
GGCTGT
Transcript >Ophio5|2083
ATGGCCTCGACGAGCCCCAGCGACGGCCATGGCTCGACGCCGGCCGGCATGAGGCCTCCGCCGGTAGAGGTCAAG
ATGCTACCGCATGGACGCCTGTTTCCCTTACAGATTGGGAGCGAGCTGTTTAAGCTGTCGGGCGCGTCTCTGTGT
TCTGACGCTCCCTCCTACTTTACCCAATACTTCCTCCGCCAGCTGGTCGCGGCCGAGCAAAGCGCAGAAGAGGCG
GCCATCCGCATACTCCACGTCGACCGCGACCCGGAGACGTTTCGCGATATCGCGCTGCATCTACAGGGCTACCCC
GTCAGCCCGAGGGACGGGACGCACTTTGTGCGGCTCTTGACCGATGCGCAGTTCTACAGCCCAGTCCCCAAGCTC
ACCTCGCAGCTCTTCGAGGGGAGCATCTTCGTCTCCATCGGGCATCGGGAGTTTCAGCTTCCGCGCGATCTCCTA
ACGAGCGCAACCAACTCGCCCAACTTCTTCTCTCTCGGCTCCGCCACCATCTTCAACCGTGCCGACGGCCTCAAC
GGTGACAAGCGTTCGGCCGTCCTGGTCCCGCCCTCGGCGCCGAAGCGGTCGGCCGATACGTTTGCCGAGTTGCTG
CGACTGCTGAAGGGATACGCCGTACGGATACGAGACGAGACGCACCGAGAGGAGCTGTTACGGGATGCGCGATAC
TTTCGCTTCAAGGGGCTCGAGCAGCAGCTCATACCGCACGCCATCAGCTTCAACCCGATTCGGAGGCGAGAAGAG
ATATGTCTGCGACTGGAGAATGTACAAAAGAGCGGCGTCAGCGTGGCGCATGAGCAGCAGCATGGCGAGGGGAGA
ACGATGGTGGCCTGGGTCAACTACGCGCGGCCCTACGTCGACGGCCGAGCGGCCGAACTGGTGCTCGAGATTGGT
GGCGACGCGACGCGCATTCACTGGGGGGGACCAGACGGGCCCAGGGCCGACTTCTTTCGCGACACAAAGGCCCGC
GTCGGCAGGCTATTCGAGGTGGTGGCCACCAAGCTGAATCTCCCCCTGACGACGCAGCCGCTGGGGCTCCTGATG
GCCTCGGGCGGCGCGAGCTCGCAGCCCGCTACGCCGGGGAACACGCCGCTGAGCGAGGACCTGGTGCGCGTCCAT
CTTTCGGCCGAGTCGGCTGTCGTGCTGGACGGGCGGCCGCTCGTACGGCCCGAGCTCGACGACGACGACGACGAC
GACGGCGGCGGCGGCGGCGGCACGAACCGGGCGAGGCGGAAGCGGAGACGCGTCGCGCCGTCGACGGGCTTTGAC
GAGGAGGTGTGGTTCGTCAGGACGGGCCAGTGGCGGTTGCGGATCCAGGGTTGTAGGGGCGGGAAGAGTGCCGTC
GAGTGCGTCCTCGTCGCGGTCAAGCTGGACGCTATCACGTCTGAGCTTGGTCGGAACCTGGCGCGGGGGTTTCTG
GGCTGTTGA
Gene >Ophio5|2083
ATGGCCTCGACGAGCCCCAGCGACGGCCATGGCTCGACGCCGGCCGGCATGAGGCCTCCGCCGGTAGAGGTCAAG
ATGCTACCGCATGGACGCCTGTTTCCCTTACAGATTGGGAGCGAGCTGTTTAAGCTGTCGGGCGCGTCTCTGTGT
TCTGACGGTTGGTTTTTTTTTTTCTTTCTCTTTCTTCTCTGACTCTCCTTGTTCCTACTTGTTCGACTTGATCGT
CCTCTACAGGGACTGACTTTTTTTTTTTTTTTTTGTATGGCAGCTCCCTCCTACTTTACCCAATACTTCCTCCGC
CAGCTGGTCGCGGCCGAGCAAAGCGCAGAAGAGGCGGCCATCCGCATACTCCACGTCGACCGCGACCCGGAGACG
TTTCGCGATATCGCGCTGCATCTACAGGGCTACCCCGTCAGCCCGAGGGACGGGACGCACTTTGTGCGGCTCTTG
ACCGATGCGCAGTTCTACAGCCGTGCGTGCTCCTCTTTACTTGGGAGACGGAAAGCCAAAGAAAAAAAGGGGAAG
AAAAAAACAAGGCTTTTTTTTACAAGGGATGAAAAGACGGGCTGGCAGGGGAGGAGGCTGATGACGCGCGCCCGC
ACGAAACACTGCAGCAGTCCCCAAGCTCACCTCGCAGCTCTTCGAGGGGAGCATCTTCGTCTCCATCGGGCATCG
GGAGTTTCAGCTTCCGCGCGATCTCCTAACGAGCGCAACCAACTCGCCCAACTTCTTCTCTCTCGGCTCCGCCAC
CATCTTCAACCGTGCCGACGGCCTCAACGGTGACAAGCGTTCGGCCGTCCTGGTCCCGCCCTCGGCGCCGAAGCG
GTCGGCCGATACGTTTGCCGAGTTGCTGCGACTGCTGAAGGGATACGCCGTACGGATACGAGACGAGACGCACCG
AGAGGAGCTGTTACGGGATGCGCGATACTTTCGCTTCAAGGGGCTCGAGCAGCAGCTCATACCGCACGCCATCAG
CTTCAACCCGATTCGGAGGCGAGAAGAGATATGTCTGCGACTGGAGAATGTACAAAAGAGCGGCGTCAGCGTGGC
GCATGAGCAGCAGCATGGCGAGGGGAGAACGATGGTGGCCTGGGTCAACTACGCGCGGCCCTACGTCGACGGCCG
AGCGGCCGAACTGGTGCTCGAGATTGGTGGCGACGCGACGCGCATTCACTGGGGGGGACCAGACGGGCCCAGGGC
CGACTTCTTTCGCGACACAAAGGCCCGCGTCGGCAGGCTATTCGAGGTGGTGGCCACCAAGCTGAATCTCCCCCT
GACGACGCAGCCGCTGGGGCTCCTGATGGCCTCGGGCGGCGCGAGCTCGCAGCCCGCTACGCCGGGGAACACGCC
GCTGAGCGAGGACCTGGTGCGCGTCCATCTTTCGGCCGAGTCGGCTGTCGTGCTGGACGGGCGGCCGCTCGTACG
GCCCGAGCTCGACGACGACGACGACGACGACGGCGGCGGCGGCGGCGGCACGAACCGGGCGAGGCGGAAGCGGAG
ACGCGTCGCGCCGTCGACGGGCTTTGACGAGGAGGTGTGGTTCGTCAGGACGGGCCAGTGGCGGTTGCGGATCCA
GGGTTGTAGGGGCGGGAAGAGTGCCGTCGAGTGCGTCCTCGTCGCGGTCAAGCTGGACGCTATCACGTCTGAGCT
TGGTCGGAACCTGGCGCGGGGGTTTCTGGGCTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail