Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2079
Gene name
Locationscaffold_184:500..2292
Strand+
Gene length (bp)1792
Transcript length (bp)1602
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 8.4E-20 98 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6N5|DS1PP_SCHPO Dihydrosphingosine 1-phosphate phosphatase C823.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.11 PE=3 SV=1 13 340 5.0E-68
sp|P47013|DS1P1_YEAST Dihydrosphingosine 1-phosphate phosphatase LCB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB3 PE=1 SV=1 4 337 2.0E-58
sp|P23501|DS1P2_YEAST Dihydrosphingosine 1-phosphate phosphatase YSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSR3 PE=3 SV=2 14 337 4.0E-49
sp|Q9M2G7|LPPD_ARATH Lipid phosphate phosphatase delta OS=Arabidopsis thaliana GN=LPPD PE=2 SV=1 48 275 2.0E-22
sp|Q55A00|SSPA_DICDI Probable sphingosine-1-phosphate phosphatase OS=Dictyostelium discoideum GN=sppA PE=3 SV=1 33 282 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6N5|DS1PP_SCHPO Dihydrosphingosine 1-phosphate phosphatase C823.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.11 PE=3 SV=1 13 340 5.0E-68
sp|P47013|DS1P1_YEAST Dihydrosphingosine 1-phosphate phosphatase LCB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB3 PE=1 SV=1 4 337 2.0E-58
sp|P23501|DS1P2_YEAST Dihydrosphingosine 1-phosphate phosphatase YSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSR3 PE=3 SV=2 14 337 4.0E-49
sp|Q9M2G7|LPPD_ARATH Lipid phosphate phosphatase delta OS=Arabidopsis thaliana GN=LPPD PE=2 SV=1 48 275 2.0E-22
sp|Q55A00|SSPA_DICDI Probable sphingosine-1-phosphate phosphatase OS=Dictyostelium discoideum GN=sppA PE=3 SV=1 33 282 1.0E-16
sp|Q8IWX5|SGPP2_HUMAN Sphingosine-1-phosphate phosphatase 2 OS=Homo sapiens GN=SGPP2 PE=2 SV=1 67 341 4.0E-15
sp|Q810K3|SGPP2_MOUSE Sphingosine-1-phosphate phosphatase 2 OS=Mus musculus GN=Sgpp2 PE=2 SV=1 67 341 1.0E-14
sp|Q99P55|SGPP1_RAT Sphingosine-1-phosphate phosphatase 1 OS=Rattus norvegicus GN=Sgpp1 PE=1 SV=2 67 206 2.0E-09
sp|Q9JI99|SGPP1_MOUSE Sphingosine-1-phosphate phosphatase 1 OS=Mus musculus GN=Sgpp1 PE=1 SV=1 67 206 5.0E-09
sp|Q9BX95|SGPP1_HUMAN Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens GN=SGPP1 PE=1 SV=2 63 206 5.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 192 214 22
3 229 248 19
4 261 278 17
5 298 320 22
6 502 524 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2079
MSIDPSLPSRPQDVPDAGLRSLDHYKRALPHWRYALRQRLLPVIRWETPYLARMQDKMRTPALDSYFAITANLGT
HTFFMIGLPLLFWCGYTSFGKGLVHILALGVFWTGFTKDLFSLPRPLSPPLQRITMSGSAALEYGFPSTHSANAV
SVAVYALLILRSPDSTLSATTKPLLEALSYFYAVSIVFGRLYCGMHGFLDVIVGSLIGAGISWLEFNYGPPLDAS
MHASSWLAPLLAGLVIVVLVRIHPEPADDCPCFDDSVAFAGVLIGLELGTWTFGKIPGDPWKTHAYGDNAIDVAP
LGWWMNLARLGFGILVIFLWRETMKPALLRLLPYLFRCLEQVGWDLPRRFFMPASEYKSVPPGSRLDTLFPKASD
FPRMVESIRHPTTRGRAVSIGPQSAADAYETLAYRERRRRESIGSSQGADRNPSNPLLASVDEDRSGKAAQASGA
EKPSPDRAWSNGEAVSSPVDDVGPRQELGETEMFLRLVRPRVRYDVEVVTKLVVYAGIAGLATACIPIMLEIVGL
GTNHLQLR
Coding >Ophio5|2079
ATGAGCATCGACCCGTCGCTGCCGTCGCGGCCCCAGGACGTCCCCGATGCCGGGCTCAGGAGCCTCGATCACTAC
AAGCGCGCGCTGCCTCATTGGCGATATGCCCTCCGCCAGCGTCTGCTCCCCGTCATCCGCTGGGAGACGCCCTAC
CTCGCCAGGATGCAGGACAAGATGCGCACGCCGGCCCTCGACAGCTACTTCGCCATCACGGCCAACCTGGGCACT
CACACCTTCTTCATGATCGGACTGCCTCTGCTCTTCTGGTGCGGCTACACGTCGTTTGGCAAAGGCCTCGTCCAC
ATCCTCGCCCTCGGCGTCTTCTGGACCGGCTTCACAAAGGACCTCTTCTCGCTGCCGCGCCCCTTGTCGCCGCCC
CTGCAACGCATCACCATGTCCGGATCGGCGGCCCTCGAGTACGGTTTCCCATCGACGCATAGCGCCAATGCCGTG
TCCGTCGCCGTCTATGCGCTCCTCATTCTGCGCAGTCCCGACAGCACGCTCTCGGCCACGACAAAACCACTTCTC
GAGGCGCTGTCCTACTTCTACGCCGTCTCCATCGTCTTCGGCCGACTATACTGCGGCATGCACGGCTTCCTCGAC
GTCATCGTCGGCTCCCTCATCGGCGCCGGTATCAGCTGGCTCGAATTCAACTATGGCCCGCCCCTGGACGCCTCC
ATGCACGCCAGCTCGTGGCTGGCTCCCTTACTGGCCGGGCTCGTCATCGTCGTCCTGGTGCGCATCCACCCGGAG
CCGGCCGACGACTGCCCATGCTTCGACGACAGCGTCGCCTTCGCCGGAGTCCTCATCGGGCTCGAGCTCGGCACA
TGGACTTTTGGCAAGATCCCCGGCGATCCGTGGAAGACGCACGCTTATGGCGACAACGCCATCGACGTAGCCCCA
CTGGGTTGGTGGATGAATCTGGCGAGGCTGGGCTTCGGCATCCTCGTCATCTTCTTGTGGCGCGAGACGATGAAG
CCGGCGCTCCTGCGGCTACTGCCCTACCTGTTCCGCTGCCTGGAGCAGGTCGGATGGGACCTTCCGCGCCGCTTC
TTCATGCCGGCGTCCGAGTACAAGTCGGTGCCGCCGGGGTCCCGGCTGGACACGCTGTTCCCCAAGGCCTCCGAC
TTTCCGCGCATGGTCGAGAGCATCCGCCACCCGACGACGCGGGGCAGGGCCGTGTCCATCGGGCCGCAGAGCGCC
GCCGACGCGTACGAGACGCTGGCGTACCGCGAGCGCCGCCGGCGCGAGAGCATCGGCAGCAGCCAGGGCGCGGAC
CGGAATCCGAGCAACCCGCTTCTCGCGAGCGTCGACGAGGACCGGTCTGGCAAGGCGGCGCAGGCGTCGGGTGCG
GAGAAGCCTTCGCCCGACCGAGCGTGGAGTAACGGCGAGGCCGTGTCATCGCCCGTCGACGACGTCGGCCCGCGG
CAAGAACTGGGCGAGACGGAAATGTTTTTGCGTCTGGTGAGGCCGCGGGTGCGGTATGACGTCGAGGTGGTGACG
AAGCTGGTCGTCTACGCAGGCATCGCGGGCCTTGCGACGGCATGCATCCCCATCATGTTGGAGATTGTCGGCCTG
GGCACGAACCACCTCCAATTGCGA
Transcript >Ophio5|2079
ATGAGCATCGACCCGTCGCTGCCGTCGCGGCCCCAGGACGTCCCCGATGCCGGGCTCAGGAGCCTCGATCACTAC
AAGCGCGCGCTGCCTCATTGGCGATATGCCCTCCGCCAGCGTCTGCTCCCCGTCATCCGCTGGGAGACGCCCTAC
CTCGCCAGGATGCAGGACAAGATGCGCACGCCGGCCCTCGACAGCTACTTCGCCATCACGGCCAACCTGGGCACT
CACACCTTCTTCATGATCGGACTGCCTCTGCTCTTCTGGTGCGGCTACACGTCGTTTGGCAAAGGCCTCGTCCAC
ATCCTCGCCCTCGGCGTCTTCTGGACCGGCTTCACAAAGGACCTCTTCTCGCTGCCGCGCCCCTTGTCGCCGCCC
CTGCAACGCATCACCATGTCCGGATCGGCGGCCCTCGAGTACGGTTTCCCATCGACGCATAGCGCCAATGCCGTG
TCCGTCGCCGTCTATGCGCTCCTCATTCTGCGCAGTCCCGACAGCACGCTCTCGGCCACGACAAAACCACTTCTC
GAGGCGCTGTCCTACTTCTACGCCGTCTCCATCGTCTTCGGCCGACTATACTGCGGCATGCACGGCTTCCTCGAC
GTCATCGTCGGCTCCCTCATCGGCGCCGGTATCAGCTGGCTCGAATTCAACTATGGCCCGCCCCTGGACGCCTCC
ATGCACGCCAGCTCGTGGCTGGCTCCCTTACTGGCCGGGCTCGTCATCGTCGTCCTGGTGCGCATCCACCCGGAG
CCGGCCGACGACTGCCCATGCTTCGACGACAGCGTCGCCTTCGCCGGAGTCCTCATCGGGCTCGAGCTCGGCACA
TGGACTTTTGGCAAGATCCCCGGCGATCCGTGGAAGACGCACGCTTATGGCGACAACGCCATCGACGTAGCCCCA
CTGGGTTGGTGGATGAATCTGGCGAGGCTGGGCTTCGGCATCCTCGTCATCTTCTTGTGGCGCGAGACGATGAAG
CCGGCGCTCCTGCGGCTACTGCCCTACCTGTTCCGCTGCCTGGAGCAGGTCGGATGGGACCTTCCGCGCCGCTTC
TTCATGCCGGCGTCCGAGTACAAGTCGGTGCCGCCGGGGTCCCGGCTGGACACGCTGTTCCCCAAGGCCTCCGAC
TTTCCGCGCATGGTCGAGAGCATCCGCCACCCGACGACGCGGGGCAGGGCCGTGTCCATCGGGCCGCAGAGCGCC
GCCGACGCGTACGAGACGCTGGCGTACCGCGAGCGCCGCCGGCGCGAGAGCATCGGCAGCAGCCAGGGCGCGGAC
CGGAATCCGAGCAACCCGCTTCTCGCGAGCGTCGACGAGGACCGGTCTGGCAAGGCGGCGCAGGCGTCGGGTGCG
GAGAAGCCTTCGCCCGACCGAGCGTGGAGTAACGGCGAGGCCGTGTCATCGCCCGTCGACGACGTCGGCCCGCGG
CAAGAACTGGGCGAGACGGAAATGTTTTTGCGTCTGGTGAGGCCGCGGGTGCGGTATGACGTCGAGGTGGTGACG
AAGCTGGTCGTCTACGCAGGCATCGCGGGCCTTGCGACGGCATGCATCCCCATCATGTTGGAGATTGTCGGCCTG
GGCACGAACCACCTCCAATTGCGATGA
Gene >Ophio5|2079
ATGAGCATCGACCCGTCGCTGCCGTCGCGGCCCCAGGACGTCCCCGATGCCGGGCTCAGGAGCCTCGATCACTGT
AAGAAAACCACATGTCGCTCTGCCGATGGAATTGCTCCCTGATGCGCTGCTGCTTGTTTTTGACAGACAAGCGCG
CGCTGCCTCATTGGCGATATGCCCTCCGCCAGCGTCTGCTCCCCGTCATCCGCTGGGAGACGCCCTACCTCGCCA
GGATGCAGGACAAGATGCGCACGCCGGCCCTCGACAGCTACTTCGCCATCACGGCCAACCTGGGCACTCACACCT
TCTTCATGATCGGACTGCCTCTGCTCTTCTGGTGCGGCTACACGTCGTTTGGCAAAGGGTATGCTATGCGCTGCG
CCCCCCCCCACCCCCCCCCTTGTGCCTAGGCGGTCGATGCTGACTCGCCAGCCTCGTCCACATCCTCGCCCTCGG
CGTCTTCTGGACCGGCTTCACAAAGGACCTCTTCTCGCTGCCGCGCCCCTTGTCGCCGCCCCTGCAACGCATCAC
CATGTCCGGATCGGCGGCCCTCGAGTACGGTTTCCCATCGACGCATAGCGCCAATGCCGTGTCCGTCGCCGTCTA
TGCGCTCCTCATTCTGCGCAGTCCCGACAGCACGCTCTCGGCCACGACAAAACCACTTCTCGAGGCGCTGTCCTA
CTTCTACGCCGTCTCCATCGTCTTCGGCCGACTATACTGCGGCATGCACGGCTTCCTCGACGTCATCGTCGGCTC
CCTCATCGGCGCCGGTATCAGCTGGCTCGAATTCAACTATGGCCCGCCCCTGGACGCCTCCATGCACGCCAGCTC
GTGGCTGGCTCCCTTACTGGCCGGGCTCGTCATCGTCGTCCTGGTGCGCATCCACCCGGAGCCGGCCGACGACTG
CCCATGCTTCGACGACAGCGTCGCCTTCGCCGGAGTCCTCATCGGGCTCGAGCTCGGCACATGGACTTTTGGCAA
GATCCCCGGCGATCCGTGGAAGACGCACGCTTATGGCGACAACGCCATCGACGTAGCCCCACTGGGTTGGTGGAT
GAATCTGGCGAGGCTGGGCTTCGGCATCCTCGTCATCTTCTTGTGGCGCGAGACGATGAAGCCGGCGCTCCTGCG
GCTACTGCCCTACCTGTTCCGCTGCCTGGAGCAGGTCGGATGGGACCTTCCGCGCCGCTTCTTCATGCCGGCGTC
CGAGTACAAGTCGGTGCCGCCGGGGTCCCGGCTGGACACGCTGTTCCCCAAGGCCTCCGACTTTCCGCGCATGGT
CGAGAGCATCCGCCACCCGACGACGCGGGGCAGGGCCGTGTCCATCGGGCCGCAGAGCGCCGCCGACGCGTACGA
GACGCTGGCGTACCGCGAGCGCCGCCGGCGCGAGAGCATCGGCAGCAGCCAGGGCGCGGACCGGAATCCGAGCAA
CCCGCTTCTCGCGAGCGTCGACGAGGACCGGTCTGGCAAGGCGGCGCAGGCGTCGGGTGCGGAGAAGCCTTCGCC
CGACCGAGCGTGGAGTAACGGCGAGGCCGTGTCATCGCCCGTCGACGACGTCGGCCCGCGGCAAGAACTGGGCGA
GACGGAAATGTTTTTGCGTCTGGTGAGGCCGCGGGTGCGGTATGACGTCGAGGTGGTGACGAAGCTGGTCGTCTA
CGCAGGTGAGCACGGCCTCGTTGAGAATAATCCGAGCGTGACTGACGGAAGAGGATCAGGCATCGCGGGCCTTGC
GACGGCATGCATCCCCATCATGTTGGAGATTGTCGGCCTGGGCACGAACCACCTCCAATTGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail