Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2066
Gene name
Locationscaffold_183:4006..5710
Strand+
Gene length (bp)1704
Transcript length (bp)1524
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 6.7E-21 64 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 48 500 2.0E-39
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 6 500 2.0E-30
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 56 232 2.0E-25
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 1 290 1.0E-13
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 64 224 8.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 48 500 2.0E-39
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 6 500 2.0E-30
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 56 232 2.0E-25
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 1 290 1.0E-13
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 64 224 8.0E-12
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 55 228 1.0E-11
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 55 234 2.0E-11
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 49 234 7.0E-11
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 55 226 2.0E-10
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 14 234 6.0E-10
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 55 271 7.0E-09
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 64 226 6.0E-08
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 64 226 9.0E-08
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 64 226 9.0E-08
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 64 226 1.0E-07
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 75 212 1.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 63 237 2.0E-07
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 52 241 3.0E-07
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 45 222 3.0E-07
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 64 226 7.0E-07
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 66 246 7.0E-07
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 64 285 9.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 63 226 1.0E-06
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 55 246 1.0E-06
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 62 234 2.0E-06
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 14 234 4.0E-06
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 58 265 4.0E-06
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 48 226 5.0E-06
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 64 265 5.0E-06
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 62 234 5.0E-06
sp|Q9T0N8|CKX1_MAIZE Cytokinin dehydrogenase 1 OS=Zea mays GN=CKX1 PE=1 SV=2 64 233 7.0E-06
sp|Q0JQ12|CKX1_ORYSJ Cytokinin dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CKX1 PE=3 SV=2 64 233 9.0E-06
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 62 234 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2066
MKNLQIILAAALARSVTGSPAAEPISVCCNTLAHELPTIFHGPVSPEYNGLVQARWSGTSMLRPACIVTPTSAGD
VSRTIRILTRHGCRFAVKGGGHNANPGANSINGGVSIDLRGLGAAHIARDRSHVSLGAGLTWGRAYDLFNNSGIG
FPGGVCEGVGVGGVSLGGGQSLFQAKMGWVVDNILEYQLVLASGKIVTASQRQRPDLFKALKGGNTNFGIVTRVK
IVAFDFPAMWSGQVVSSIDHGPSNRSAMLDSVSHTMVNFVTDNNKDVDSEVQLAMTYLRNNGGQVASAAISNVAD
VANPPSLRGFSTLPNQVSYTARHGKIADFTHQLSRFQPTGFRQVTAGVTITNDFETLRHIWDASDEVYNSLPQKD
KVDWIVVLFPQPVIQQAYSEKRGGNSLGLSKNKEDQIVVWLASRWSDPNLDGMMEQARRDFVKATVAVAKKHKTY
SPFLYINYAGPDQDPLCGYGAQTVAFLKRTAEKYDPNGVFQKLMPGGFKVSQAKCAR
Coding >Ophio5|2066
ATGAAGAATCTCCAGATCATCCTGGCTGCGGCTCTAGCCCGCTCCGTCACGGGGAGTCCGGCCGCTGAGCCCATC
TCCGTCTGCTGCAACACGCTCGCCCACGAGCTTCCCACCATCTTCCACGGGCCAGTATCGCCAGAGTACAATGGT
CTGGTGCAGGCCCGTTGGTCTGGAACGTCGATGCTGCGACCAGCTTGTATCGTCACGCCCACGTCTGCCGGGGAT
GTTTCCCGGACGATACGCATCTTGACACGGCACGGCTGTCGGTTTGCCGTCAAGGGCGGTGGTCATAATGCCAAT
CCCGGCGCTAATAGCATCAACGGCGGCGTCTCCATCGATCTTCGTGGCCTTGGTGCCGCTCATATCGCCAGGGAC
CGGTCCCACGTGAGTCTCGGCGCTGGCTTGACCTGGGGCCGAGCCTATGATCTGTTTAATAATAGCGGTATTGGA
TTTCCGGGGGGCGTCTGCGAGGGCGTCGGCGTTGGGGGCGTATCTCTAGGAGGTGGCCAGTCCCTGTTCCAGGCC
AAGATGGGCTGGGTCGTCGACAATATCCTGGAATATCAGCTCGTCCTAGCCTCGGGGAAGATCGTCACCGCCAGC
CAGAGACAACGTCCGGACCTGTTCAAGGCGCTCAAGGGGGGAAACACCAACTTCGGCATCGTCACGCGCGTCAAG
ATTGTCGCCTTTGACTTCCCGGCCATGTGGAGTGGCCAAGTGGTGTCCAGCATCGACCATGGGCCTAGCAACCGG
TCGGCGATGCTCGATAGCGTCAGTCATACCATGGTCAACTTCGTGACCGATAACAACAAGGATGTCGACTCGGAA
GTGCAACTCGCCATGACGTATCTCCGCAATAACGGCGGTCAGGTTGCCAGCGCGGCCATCTCCAACGTCGCCGAC
GTCGCTAATCCGCCCTCCCTTCGAGGCTTCTCGACCTTACCGAACCAAGTATCGTACACGGCCCGGCACGGGAAG
ATTGCCGACTTTACCCATCAGCTCAGCCGCTTTCAGCCAACCGGTTTCCGCCAAGTCACTGCCGGCGTGACCATC
ACCAACGACTTTGAGACTCTTCGCCACATCTGGGATGCCTCGGATGAAGTGTATAACTCGTTGCCGCAAAAGGAC
AAGGTTGACTGGATCGTCGTCTTGTTCCCGCAGCCCGTCATTCAGCAAGCGTACTCGGAGAAACGGGGCGGCAAC
AGCCTCGGTCTCTCTAAGAATAAGGAGGACCAAATAGTCGTTTGGTTGGCTTCGCGCTGGTCCGACCCTAACCTC
GACGGCATGATGGAACAAGCTCGACGCGACTTCGTCAAGGCCACGGTGGCGGTAGCAAAGAAGCATAAGACGTAC
TCTCCGTTCCTCTACATCAACTATGCTGGTCCAGATCAGGATCCTCTCTGCGGCTACGGCGCCCAGACCGTCGCC
TTTCTCAAGCGGACTGCCGAGAAATACGACCCCAACGGCGTCTTCCAGAAGCTGATGCCGGGAGGATTCAAGGTC
AGTCAGGCGAAGTGTGCCAGG
Transcript >Ophio5|2066
ATGAAGAATCTCCAGATCATCCTGGCTGCGGCTCTAGCCCGCTCCGTCACGGGGAGTCCGGCCGCTGAGCCCATC
TCCGTCTGCTGCAACACGCTCGCCCACGAGCTTCCCACCATCTTCCACGGGCCAGTATCGCCAGAGTACAATGGT
CTGGTGCAGGCCCGTTGGTCTGGAACGTCGATGCTGCGACCAGCTTGTATCGTCACGCCCACGTCTGCCGGGGAT
GTTTCCCGGACGATACGCATCTTGACACGGCACGGCTGTCGGTTTGCCGTCAAGGGCGGTGGTCATAATGCCAAT
CCCGGCGCTAATAGCATCAACGGCGGCGTCTCCATCGATCTTCGTGGCCTTGGTGCCGCTCATATCGCCAGGGAC
CGGTCCCACGTGAGTCTCGGCGCTGGCTTGACCTGGGGCCGAGCCTATGATCTGTTTAATAATAGCGGTATTGGA
TTTCCGGGGGGCGTCTGCGAGGGCGTCGGCGTTGGGGGCGTATCTCTAGGAGGTGGCCAGTCCCTGTTCCAGGCC
AAGATGGGCTGGGTCGTCGACAATATCCTGGAATATCAGCTCGTCCTAGCCTCGGGGAAGATCGTCACCGCCAGC
CAGAGACAACGTCCGGACCTGTTCAAGGCGCTCAAGGGGGGAAACACCAACTTCGGCATCGTCACGCGCGTCAAG
ATTGTCGCCTTTGACTTCCCGGCCATGTGGAGTGGCCAAGTGGTGTCCAGCATCGACCATGGGCCTAGCAACCGG
TCGGCGATGCTCGATAGCGTCAGTCATACCATGGTCAACTTCGTGACCGATAACAACAAGGATGTCGACTCGGAA
GTGCAACTCGCCATGACGTATCTCCGCAATAACGGCGGTCAGGTTGCCAGCGCGGCCATCTCCAACGTCGCCGAC
GTCGCTAATCCGCCCTCCCTTCGAGGCTTCTCGACCTTACCGAACCAAGTATCGTACACGGCCCGGCACGGGAAG
ATTGCCGACTTTACCCATCAGCTCAGCCGCTTTCAGCCAACCGGTTTCCGCCAAGTCACTGCCGGCGTGACCATC
ACCAACGACTTTGAGACTCTTCGCCACATCTGGGATGCCTCGGATGAAGTGTATAACTCGTTGCCGCAAAAGGAC
AAGGTTGACTGGATCGTCGTCTTGTTCCCGCAGCCCGTCATTCAGCAAGCGTACTCGGAGAAACGGGGCGGCAAC
AGCCTCGGTCTCTCTAAGAATAAGGAGGACCAAATAGTCGTTTGGTTGGCTTCGCGCTGGTCCGACCCTAACCTC
GACGGCATGATGGAACAAGCTCGACGCGACTTCGTCAAGGCCACGGTGGCGGTAGCAAAGAAGCATAAGACGTAC
TCTCCGTTCCTCTACATCAACTATGCTGGTCCAGATCAGGATCCTCTCTGCGGCTACGGCGCCCAGACCGTCGCC
TTTCTCAAGCGGACTGCCGAGAAATACGACCCCAACGGCGTCTTCCAGAAGCTGATGCCGGGAGGATTCAAGGTC
AGTCAGGCGAAGTGTGCCAGGTGA
Gene >Ophio5|2066
ATGAAGAATCTCCAGATCATCCTGGCTGCGGCTCTAGCCCGCTCCGTCACGGGGAGTCCGGCCGCTGAGCCCATC
TCCGTCTGCGTAAGCCCGATCAAGCGCTTCCGAGACGGGGACACGTCGTCCAACTGAACCATCCTTCTTGCAGTG
CAACACGCTCGCCCACGAGCTTCCCACCATCTTCCACGGGCCAGTATCGCCAGAGTACAATGGTCTGGTGCAGGC
CCGTTGGTCTGGAACGTCGATGCTGCGACCAGCTTGTATCGTCACGCCCACGTCTGCCGGGGATGTTTCCCGGAC
GATACGCATCTTGACACGGCACGGCTGTCGGTTTGCCGTCAAGGGCGGTGGTCATAATGCCAATCCCGGCGCTAA
TAGCATCAACGGCGGCGTCTCCATCGATCTTCGTGGCCTTGGTGCCGCTCATATCGCCAGGGACCGGTCCCACGT
GAGTCTCGGCGCTGGCTTGACCTGGGGCCGAGCCTATGATCTGTTTAATAATAGCGGTATTGGATTTCCGGGGGG
CGTCTGCGAGGGCGTCGGCGTTGGGGGCGTATCTCTAGGAGGTGGCCAGTCCCTGTTCCAGGCCAAGATGGGCTG
GGTCGTCGACAATATCCTGGAATATCAGCTCGTCCTAGCCTCGGGGAAGATCGTCACCGCCAGCCAGAGACAACG
TCCGGACCTGTTCAAGGCGCTCAAGGGGGGAAACACCAACTTCGGCATCGTCACGCGCGTCAAGATTGTCGCCTT
TGACTTCCCGGCCATGTGGAGTGGCCAAGTGGTGTCCAGCATCGACCATGGGCCTAGCAACCGGTCGGCGATGCT
CGATAGCGTCAGTCATACCATGGTCAACTTCGTGACCGATAACAACAAGGATGTCGACTCGGAAGTGCAACTCGC
CATGACGTATCTCCGCAATAACGGCGGTCAGGTTGCCAGCGCGGCCATCTCCAACGTCGCCGACGTCGCTAATCC
GCCCTCCCTTCGAGGCTTCTCGACCTTACCGAACCAAGTATCGTACACGGCCCGGCACGGGAAGATTGCCGACTT
TACCCATCAGCTCAGCCGCTTTCAGCCAACCGGTTTCCGGTAAGCCTTTTTTTTCACTCGTCTGGTTTAGCCGTC
GTTGTTTTTCTAACTTTGCTCGACCAGCCAAGTCACTGCCGGCGTGACCATCACCAACGACTTTGAGACTCTTCG
CCACATCTGGGATGCCTCGGATGAAGTGTATAACTCGTTGCCGCAAAAGGACAAGGTTGACTGGATCGTCGTCTT
GTTCCCGCAGCCCGTCATTCAGCAAGCGTACTCGGAGAAACGGGGCGGCAACAGCCTCGGTCTCTCTAAGAATAA
GGAGGACCAAATAGGTGAGTCCTCGAAGATCCATACGTTGTCTGCTGTGTCTCTAAAACAATGGCAGTCGTTTGG
TTGGCTTCGCGCTGGTCCGACCCTAACCTCGACGGCATGATGGAACAAGCTCGACGCGACTTCGTCAAGGCCACG
GTGGCGGTAGCAAAGAAGCATAAGACGTACTCTCCGTTCCTCTACATCAACTATGCTGGTCCAGATCAGGATCCT
CTCTGCGGCTACGGCGCCCAGACCGTCGCCTTTCTCAAGCGGACTGCCGAGAAATACGACCCCAACGGCGTCTTC
CAGAAGCTGATGCCGGGAGGATTCAAGGTCAGTCAGGCGAAGTGTGCCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail