Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2062
Gene name
Locationscaffold_182:31391..33008
Strand+
Gene length (bp)1617
Transcript length (bp)1617
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.3E-39 27 429
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 7.1E-15 39 304
PF00083 Sugar_tr Sugar (and other) transporter 5.1E-10 54 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 19 535 2.0E-59
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 19 535 4.0E-59
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 22 535 6.0E-56
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 15 532 1.0E-53
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 33 450 6.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 19 535 2.0E-59
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 19 535 4.0E-59
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 22 535 6.0E-56
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 15 532 1.0E-53
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 33 450 6.0E-50
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 19 521 1.0E-39
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 19 521 1.0E-39
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 23 467 8.0E-38
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 17 459 4.0E-37
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 1 432 3.0E-33
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 37 440 2.0E-31
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 25 523 1.0E-29
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 29 366 1.0E-28
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 29 366 1.0E-28
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 21 368 1.0E-27
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 21 368 1.0E-27
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 111 459 4.0E-27
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 60 522 1.0E-24
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 32 477 2.0E-24
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 7 452 3.0E-24
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 7 452 3.0E-24
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 37 523 3.0E-24
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 26 450 1.0E-23
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 25 331 4.0E-23
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 29 429 4.0E-21
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 28 438 7.0E-21
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 27 446 7.0E-21
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 22 459 2.0E-20
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 27 446 3.0E-20
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 60 399 4.0E-20
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 27 446 1.0E-19
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 22 459 2.0E-19
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 27 437 6.0E-19
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 27 437 6.0E-19
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 27 436 1.0E-18
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 27 436 1.0E-18
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 27 436 1.0E-18
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 27 436 1.0E-18
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 27 436 1.0E-18
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 27 436 2.0E-18
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 27 436 2.0E-18
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 27 436 2.0E-18
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 5 284 3.0E-18
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 33 443 3.0E-18
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 9 450 3.0E-18
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 27 436 4.0E-18
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 27 434 7.0E-18
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 27 434 1.0E-17
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 19 471 1.0E-17
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 19 471 1.0E-17
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 32 348 2.0E-17
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 19 446 5.0E-17
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 27 446 5.0E-17
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 27 446 9.0E-17
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 27 446 9.0E-17
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 27 446 9.0E-17
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 27 446 2.0E-16
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 27 446 3.0E-16
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 27 446 3.0E-16
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 27 446 3.0E-16
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 27 446 3.0E-16
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 27 446 3.0E-16
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 27 446 3.0E-16
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 27 446 3.0E-16
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 27 371 4.0E-16
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 27 446 4.0E-16
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 32 329 6.0E-16
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 27 446 7.0E-16
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 18 454 2.0E-15
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 27 446 3.0E-15
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 28 234 6.0E-15
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 27 352 9.0E-15
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 15 352 1.0E-14
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 23 329 1.0E-14
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 27 352 2.0E-14
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 15 450 2.0E-14
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 27 352 1.0E-13
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 27 352 1.0E-13
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 27 352 1.0E-13
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 27 352 1.0E-13
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 27 352 1.0E-13
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 27 352 1.0E-13
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 27 352 1.0E-13
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 27 352 1.0E-13
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 45 203 2.0E-13
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 19 448 2.0E-13
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 19 448 2.0E-13
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 19 214 3.0E-13
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 23 349 3.0E-13
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 28 186 3.0E-13
sp|A7MHI9|MDTD_CROS8 Putative multidrug resistance protein MdtD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtD PE=3 SV=1 27 352 4.0E-13
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 20 328 5.0E-13
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 20 328 5.0E-13
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 67 439 8.0E-13
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 27 352 9.0E-13
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 21 432 1.0E-12
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 10 349 1.0E-12
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 19 203 1.0E-12
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 19 203 1.0E-12
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 45 207 2.0E-12
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 10 349 2.0E-12
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 19 214 2.0E-12
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 19 203 3.0E-12
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 19 203 3.0E-12
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 19 203 3.0E-12
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 19 203 3.0E-12
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 19 203 3.0E-12
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 19 203 3.0E-12
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 45 223 4.0E-12
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 19 203 6.0E-12
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 19 203 6.0E-12
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 19 203 6.0E-12
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 28 216 8.0E-12
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 28 216 8.0E-12
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 28 216 8.0E-12
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 28 216 8.0E-12
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 28 216 8.0E-12
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 28 216 8.0E-12
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 28 216 8.0E-12
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 28 216 8.0E-12
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 76 451 1.0E-11
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 9 329 1.0E-11
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 45 212 2.0E-11
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 45 211 5.0E-11
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 45 211 5.0E-11
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 45 211 9.0E-11
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 45 211 9.0E-11
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 45 211 9.0E-11
sp|P9WJX3|Y1634_MYCTU Probable multidrug-efflux transporter Rv1634 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1634 PE=1 SV=1 45 180 2.0E-10
sp|P9WJX2|Y1634_MYCTO Probable multidrug-efflux transporter MT1670 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1670 PE=3 SV=1 45 180 2.0E-10
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 45 216 2.0E-10
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 45 211 2.0E-10
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 45 211 2.0E-10
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 45 211 2.0E-10
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 45 216 3.0E-10
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 45 216 3.0E-10
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 45 211 3.0E-10
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 45 211 4.0E-10
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 45 211 4.0E-10
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 45 211 4.0E-10
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 45 211 4.0E-10
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 45 211 4.0E-10
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 45 211 4.0E-10
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 67 538 4.0E-10
sp|P14551|TCR_STRRM Tetracycline resistance determinant OS=Streptomyces rimosus GN=tetB PE=3 SV=1 273 459 5.0E-10
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 45 211 5.0E-10
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 45 216 6.0E-10
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 19 436 7.0E-10
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 19 436 7.0E-10
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 45 211 7.0E-10
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 45 211 1.0E-09
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 45 211 1.0E-09
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 45 211 1.0E-09
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 45 211 1.0E-09
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 45 211 1.0E-09
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 45 211 1.0E-09
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 19 241 1.0E-09
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 45 211 1.0E-09
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 45 211 2.0E-09
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 20 386 7.0E-09
sp|Q8EA87|MDTL_SHEON Multidrug resistance protein MdtL OS=Shewanella oneidensis (strain MR-1) GN=mdtL PE=3 SV=1 45 199 9.0E-09
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 10 182 4.0E-08
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 19 439 7.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 28 204 8.0E-08
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 18 213 1.0E-07
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 20 186 2.0E-07
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 20 186 2.0E-07
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 25 204 7.0E-07
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 25 204 7.0E-07
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 5 182 1.0E-06
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 26 437 2.0E-06
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 60 455 2.0E-06
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 19 187 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 57 79 22
3 91 113 22
4 117 134 17
5 146 168 22
6 178 200 22
7 217 239 22
8 243 265 22
9 286 308 22
10 323 345 22
11 352 374 22
12 384 406 22
13 418 440 22
14 494 516 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2062
MVDVMGLEAENPVGGKGARFWLVFVAIALTTFLAAVDTSILSTALPTIAQALGSEELYVWISNAYLVASTATIPI
FAQAANIYGRRNLTLLAVCLFSLGSGLCGGAVSTAMMIAGRAVQGVGGGGILTMSEIVICDTVSVRERGLYAGLL
GGIWAIASVVAPILGGVLAQGGDGSWRWIFYLNLPIAGLALGLLVVFLRLRRPPSGSVGEQLTRVDWGGAALLVP
SVAAVVLALGWGGSRYPWSSWHVALPLAAGLAGLVAFIAYQASPWLREPTMPLRIFTNRASALCLAISFLHSMLL
FWACYFLPVYFQAVCEASPTRSAVMLFPIATTSAPAGVLAGILITRTGRYRVWHLLGLALTTLGCGLCTLLDASS
STGHWVGFQLLLGFGFGFVFTSTLPPILASLPETDVATATGAWTFLRNFGSVWGIAIPGAIFNTVSSDAASRLSD
PVVRGLLVDGGAYEHATRSFMLSLEANPTLQAEVIQLYVGGLRTVWQASIVFAVLAFALALFVPALELRDELKTE
YGLEKHNRSDTSS
Coding >Ophio5|2062
ATGGTGGACGTAATGGGCTTGGAAGCGGAGAATCCGGTTGGCGGAAAAGGGGCTCGCTTCTGGCTCGTCTTTGTG
GCCATTGCTCTCACGACCTTCCTCGCCGCCGTGGATACGTCGATCCTCTCGACGGCATTGCCGACTATTGCCCAA
GCGCTCGGATCCGAAGAGCTCTACGTATGGATCTCTAACGCTTACCTGGTCGCTTCGACGGCCACGATTCCCATC
TTCGCCCAGGCGGCCAACATCTACGGTCGACGGAATCTCACCCTGTTGGCTGTCTGCCTCTTCTCGCTTGGGAGT
GGCCTGTGTGGTGGTGCCGTTTCTACGGCCATGATGATTGCCGGTCGCGCGGTGCAGGGCGTTGGCGGCGGTGGT
ATCCTGACCATGTCGGAGATTGTCATCTGCGATACTGTCTCCGTCCGGGAGAGAGGCCTTTACGCGGGCCTCTTG
GGCGGTATCTGGGCTATCGCCTCGGTCGTGGCCCCTATTCTGGGAGGTGTCTTGGCTCAAGGAGGAGACGGATCG
TGGCGATGGATCTTCTATCTCAATCTTCCCATCGCTGGTCTCGCCTTGGGTCTTCTTGTCGTCTTCCTCCGCCTG
CGTCGTCCACCGTCCGGCTCCGTGGGCGAGCAGCTGACGCGCGTCGACTGGGGCGGCGCCGCACTCCTCGTCCCC
TCTGTTGCTGCCGTCGTCCTCGCTCTCGGCTGGGGGGGATCTCGTTACCCCTGGTCCTCGTGGCATGTTGCTCTA
CCGCTGGCTGCTGGCCTCGCTGGTCTCGTCGCCTTCATCGCCTATCAGGCCAGCCCCTGGCTGAGGGAGCCCACC
ATGCCGCTGCGCATCTTCACCAACCGTGCCTCGGCTCTGTGTCTCGCCATCAGCTTCTTGCACAGCATGCTTCTC
TTCTGGGCCTGCTATTTCCTGCCCGTCTACTTTCAGGCCGTCTGCGAAGCCAGTCCGACGCGCTCTGCCGTCATG
CTCTTCCCCATAGCCACTACCAGCGCCCCTGCCGGCGTGTTGGCTGGCATTCTCATCACTCGGACCGGTCGCTAC
CGTGTTTGGCACTTGCTTGGTCTGGCTCTGACCACGCTGGGCTGCGGCTTGTGCACTCTGCTCGACGCCTCCTCC
TCCACGGGGCACTGGGTTGGTTTCCAACTGCTGCTCGGCTTTGGCTTCGGTTTCGTCTTCACCAGCACTTTGCCG
CCCATCTTGGCCAGCCTTCCTGAGACCGACGTCGCTACGGCCACCGGTGCCTGGACTTTCCTTCGAAACTTTGGC
TCCGTCTGGGGCATCGCCATCCCCGGTGCCATCTTCAACACCGTCTCGAGTGATGCCGCCTCTCGCCTCTCGGAT
CCTGTCGTGAGAGGTTTGCTCGTCGATGGCGGAGCGTACGAGCATGCAACAAGGAGTTTCATGCTCTCCCTCGAG
GCCAATCCTACACTCCAAGCCGAGGTAATACAACTCTACGTAGGCGGATTACGAACCGTGTGGCAGGCTTCGATT
GTCTTTGCCGTCTTGGCCTTTGCATTGGCCCTCTTCGTCCCCGCCTTGGAGCTGCGAGACGAGCTCAAGACGGAA
TACGGGCTGGAGAAGCACAATCGGTCGGATACGTCGTCA
Transcript >Ophio5|2062
ATGGTGGACGTAATGGGCTTGGAAGCGGAGAATCCGGTTGGCGGAAAAGGGGCTCGCTTCTGGCTCGTCTTTGTG
GCCATTGCTCTCACGACCTTCCTCGCCGCCGTGGATACGTCGATCCTCTCGACGGCATTGCCGACTATTGCCCAA
GCGCTCGGATCCGAAGAGCTCTACGTATGGATCTCTAACGCTTACCTGGTCGCTTCGACGGCCACGATTCCCATC
TTCGCCCAGGCGGCCAACATCTACGGTCGACGGAATCTCACCCTGTTGGCTGTCTGCCTCTTCTCGCTTGGGAGT
GGCCTGTGTGGTGGTGCCGTTTCTACGGCCATGATGATTGCCGGTCGCGCGGTGCAGGGCGTTGGCGGCGGTGGT
ATCCTGACCATGTCGGAGATTGTCATCTGCGATACTGTCTCCGTCCGGGAGAGAGGCCTTTACGCGGGCCTCTTG
GGCGGTATCTGGGCTATCGCCTCGGTCGTGGCCCCTATTCTGGGAGGTGTCTTGGCTCAAGGAGGAGACGGATCG
TGGCGATGGATCTTCTATCTCAATCTTCCCATCGCTGGTCTCGCCTTGGGTCTTCTTGTCGTCTTCCTCCGCCTG
CGTCGTCCACCGTCCGGCTCCGTGGGCGAGCAGCTGACGCGCGTCGACTGGGGCGGCGCCGCACTCCTCGTCCCC
TCTGTTGCTGCCGTCGTCCTCGCTCTCGGCTGGGGGGGATCTCGTTACCCCTGGTCCTCGTGGCATGTTGCTCTA
CCGCTGGCTGCTGGCCTCGCTGGTCTCGTCGCCTTCATCGCCTATCAGGCCAGCCCCTGGCTGAGGGAGCCCACC
ATGCCGCTGCGCATCTTCACCAACCGTGCCTCGGCTCTGTGTCTCGCCATCAGCTTCTTGCACAGCATGCTTCTC
TTCTGGGCCTGCTATTTCCTGCCCGTCTACTTTCAGGCCGTCTGCGAAGCCAGTCCGACGCGCTCTGCCGTCATG
CTCTTCCCCATAGCCACTACCAGCGCCCCTGCCGGCGTGTTGGCTGGCATTCTCATCACTCGGACCGGTCGCTAC
CGTGTTTGGCACTTGCTTGGTCTGGCTCTGACCACGCTGGGCTGCGGCTTGTGCACTCTGCTCGACGCCTCCTCC
TCCACGGGGCACTGGGTTGGTTTCCAACTGCTGCTCGGCTTTGGCTTCGGTTTCGTCTTCACCAGCACTTTGCCG
CCCATCTTGGCCAGCCTTCCTGAGACCGACGTCGCTACGGCCACCGGTGCCTGGACTTTCCTTCGAAACTTTGGC
TCCGTCTGGGGCATCGCCATCCCCGGTGCCATCTTCAACACCGTCTCGAGTGATGCCGCCTCTCGCCTCTCGGAT
CCTGTCGTGAGAGGTTTGCTCGTCGATGGCGGAGCGTACGAGCATGCAACAAGGAGTTTCATGCTCTCCCTCGAG
GCCAATCCTACACTCCAAGCCGAGGTAATACAACTCTACGTAGGCGGATTACGAACCGTGTGGCAGGCTTCGATT
GTCTTTGCCGTCTTGGCCTTTGCATTGGCCCTCTTCGTCCCCGCCTTGGAGCTGCGAGACGAGCTCAAGACGGAA
TACGGGCTGGAGAAGCACAATCGGTCGGATACGTCGTCATGA
Gene >Ophio5|2062
ATGGTGGACGTAATGGGCTTGGAAGCGGAGAATCCGGTTGGCGGAAAAGGGGCTCGCTTCTGGCTCGTCTTTGTG
GCCATTGCTCTCACGACCTTCCTCGCCGCCGTGGATACGTCGATCCTCTCGACGGCATTGCCGACTATTGCCCAA
GCGCTCGGATCCGAAGAGCTCTACGTATGGATCTCTAACGCTTACCTGGTCGCTTCGACGGCCACGATTCCCATC
TTCGCCCAGGCGGCCAACATCTACGGTCGACGGAATCTCACCCTGTTGGCTGTCTGCCTCTTCTCGCTTGGGAGT
GGCCTGTGTGGTGGTGCCGTTTCTACGGCCATGATGATTGCCGGTCGCGCGGTGCAGGGCGTTGGCGGCGGTGGT
ATCCTGACCATGTCGGAGATTGTCATCTGCGATACTGTCTCCGTCCGGGAGAGAGGCCTTTACGCGGGCCTCTTG
GGCGGTATCTGGGCTATCGCCTCGGTCGTGGCCCCTATTCTGGGAGGTGTCTTGGCTCAAGGAGGAGACGGATCG
TGGCGATGGATCTTCTATCTCAATCTTCCCATCGCTGGTCTCGCCTTGGGTCTTCTTGTCGTCTTCCTCCGCCTG
CGTCGTCCACCGTCCGGCTCCGTGGGCGAGCAGCTGACGCGCGTCGACTGGGGCGGCGCCGCACTCCTCGTCCCC
TCTGTTGCTGCCGTCGTCCTCGCTCTCGGCTGGGGGGGATCTCGTTACCCCTGGTCCTCGTGGCATGTTGCTCTA
CCGCTGGCTGCTGGCCTCGCTGGTCTCGTCGCCTTCATCGCCTATCAGGCCAGCCCCTGGCTGAGGGAGCCCACC
ATGCCGCTGCGCATCTTCACCAACCGTGCCTCGGCTCTGTGTCTCGCCATCAGCTTCTTGCACAGCATGCTTCTC
TTCTGGGCCTGCTATTTCCTGCCCGTCTACTTTCAGGCCGTCTGCGAAGCCAGTCCGACGCGCTCTGCCGTCATG
CTCTTCCCCATAGCCACTACCAGCGCCCCTGCCGGCGTGTTGGCTGGCATTCTCATCACTCGGACCGGTCGCTAC
CGTGTTTGGCACTTGCTTGGTCTGGCTCTGACCACGCTGGGCTGCGGCTTGTGCACTCTGCTCGACGCCTCCTCC
TCCACGGGGCACTGGGTTGGTTTCCAACTGCTGCTCGGCTTTGGCTTCGGTTTCGTCTTCACCAGCACTTTGCCG
CCCATCTTGGCCAGCCTTCCTGAGACCGACGTCGCTACGGCCACCGGTGCCTGGACTTTCCTTCGAAACTTTGGC
TCCGTCTGGGGCATCGCCATCCCCGGTGCCATCTTCAACACCGTCTCGAGTGATGCCGCCTCTCGCCTCTCGGAT
CCTGTCGTGAGAGGTTTGCTCGTCGATGGCGGAGCGTACGAGCATGCAACAAGGAGTTTCATGCTCTCCCTCGAG
GCCAATCCTACACTCCAAGCCGAGGTAATACAACTCTACGTAGGCGGATTACGAACCGTGTGGCAGGCTTCGATT
GTCTTTGCCGTCTTGGCCTTTGCATTGGCCCTCTTCGTCCCCGCCTTGGAGCTGCGAGACGAGCTCAAGACGGAA
TACGGGCTGGAGAAGCACAATCGGTCGGATACGTCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail