Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2058
Gene name
Locationscaffold_182:15635..16374
Strand-
Gene length (bp)739
Transcript length (bp)675
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 3.1E-15 3 76
PF00043 GST_C Glutathione S-transferase, C-terminal domain 1.7E-09 126 193
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 1.3E-08 130 191
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 8.8E-07 23 76
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 7.4E-06 135 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P26642|EF1GA_XENLA Elongation factor 1-gamma-A OS=Xenopus laevis GN=eef1g-a PE=1 SV=1 3 224 2.0E-45
sp|Q68FR6|EF1G_RAT Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=2 SV=3 3 205 6.0E-43
sp|P29694|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3 3 205 6.0E-43
sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3 3 205 8.0E-43
sp|A2Q127|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1 3 205 9.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P26642|EF1GA_XENLA Elongation factor 1-gamma-A OS=Xenopus laevis GN=eef1g-a PE=1 SV=1 3 224 2.0E-45
sp|Q68FR6|EF1G_RAT Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=2 SV=3 3 205 6.0E-43
sp|P29694|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3 3 205 6.0E-43
sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3 3 205 8.0E-43
sp|A2Q127|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1 3 205 9.0E-43
sp|Q4R7H5|EF1G_MACFA Elongation factor 1-gamma OS=Macaca fascicularis GN=EEF1G PE=2 SV=1 3 205 9.0E-43
sp|Q29387|EF1G_PIG Elongation factor 1-gamma (Fragment) OS=Sus scrofa GN=EEF1G PE=2 SV=2 5 205 1.0E-42
sp|Q3SZV3|EF1G_BOVIN Elongation factor 1-gamma OS=Bos taurus GN=EEF1G PE=2 SV=1 3 205 1.0E-42
sp|Q90YC0|EF1G_CARAU Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1 3 224 2.0E-42
sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens GN=EEF1G PE=1 SV=3 3 205 6.0E-42
sp|Q6PE25|EF1G_DANRE Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1 3 224 8.0E-42
sp|Q91375|EF1GB_XENLA Elongation factor 1-gamma-B OS=Xenopus laevis GN=eef1g-b PE=2 SV=1 3 210 4.0E-41
sp|P12261|EF1G_ARTSA Elongation factor 1-gamma OS=Artemia salina PE=1 SV=3 3 205 6.0E-40
sp|Q9NJH0|EF1G_DROME Elongation factor 1-gamma OS=Drosophila melanogaster GN=Ef1gamma PE=2 SV=2 3 203 4.0E-30
sp|Q9ZRI7|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1 5 205 4.0E-28
sp|Q00717|STCT_EMENI Putative sterigmatocystin biosynthesis protein stcT OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcT PE=4 SV=1 2 209 1.0E-27
sp|Q6YW46|EF1G2_ORYSJ Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2 11 205 8.0E-27
sp|Q5Z627|EF1G3_ORYSJ Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1 11 205 6.0E-26
sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1 11 205 1.0E-25
sp|Q9FVT2|EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1 5 205 2.0E-25
sp|O04487|EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1 5 205 2.0E-23
sp|B5BP46|YP52_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.02c PE=3 SV=1 3 192 2.0E-19
sp|P54412|EF1G_CAEEL Probable elongation factor 1-gamma OS=Caenorhabditis elegans GN=eef-1G PE=3 SV=1 1 211 2.0E-17
sp|O74830|YC12_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.02 PE=3 SV=1 3 192 8.0E-15
sp|P40921|EF1G_SCHPO Elongation factor 1-gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 3 191 8.0E-14
sp|P46423|GSTF_HYOMU Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1 14 190 2.0E-12
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 43 191 1.0E-11
sp|Q04462|SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus GN=Vars PE=2 SV=2 33 205 2.0E-11
sp|Q9Z1Q9|SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus GN=Vars PE=1 SV=1 33 214 9.0E-11
sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 33 205 1.0E-10
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 88 205 1.0E-10
sp|P36008|EF1G2_YEAST Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF4 PE=1 SV=1 40 217 2.0E-10
sp|Q9LZI9|GSTFD_ARATH Glutathione S-transferase F13 OS=Arabidopsis thaliana GN=GSTF13 PE=3 SV=1 39 191 2.0E-10
sp|Q52828|GSTA_RHILE Protein GstA OS=Rhizobium leguminosarum GN=gstA PE=3 SV=1 38 166 5.0E-10
sp|P34715|EF1G_TRYCR Elongation factor 1-gamma OS=Trypanosoma cruzi PE=2 SV=1 11 172 5.0E-10
sp|Q9SRY5|GSTF7_ARATH Glutathione S-transferase F7 OS=Arabidopsis thaliana GN=GSTF7 PE=2 SV=3 44 190 6.0E-10
sp|Q9VG96|GSTD4_DROME Glutathione S-transferase D4 OS=Drosophila melanogaster GN=GstD4 PE=1 SV=1 22 191 7.0E-10
sp|P30109|GSTF1_TOBAC Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1 44 190 1.0E-09
sp|P46440|GSTF2_TOBAC Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1 44 190 1.0E-09
sp|P42760|GSTF6_ARATH Glutathione S-transferase F6 OS=Arabidopsis thaliana GN=GSTF6 PE=2 SV=2 44 190 2.0E-09
sp|Q93112|GST1C_ANOGA Glutathione S-transferase 1, isoform C OS=Anopheles gambiae GN=GstD1 PE=1 SV=2 13 204 3.0E-09
sp|P42936|YG4D_YEAST Putative elongation factor 1 gamma homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR201C PE=4 SV=3 47 195 3.0E-09
sp|O65857|GSTF1_ORYSJ Probable glutathione S-transferase GSTF1 OS=Oryza sativa subsp. japonica GN=GSTF1 PE=1 SV=2 4 203 1.0E-08
sp|Q9SLM6|GSTF3_ARATH Glutathione S-transferase F3 OS=Arabidopsis thaliana GN=GSTF3 PE=2 SV=1 44 190 3.0E-08
sp|P12653|GSTF1_MAIZE Glutathione S-transferase 1 OS=Zea mays GN=GST1 PE=1 SV=4 39 206 3.0E-08
sp|P57109|MAAI_PSEAE Maleylacetoacetate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=maiA PE=3 SV=1 4 168 9.0E-08
sp|P45875|GST_XANCP Glutathione S-transferase GST-4.5 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gst PE=1 SV=3 37 171 1.0E-07
sp|P28342|GSTZ1_DIACA Glutathione S-transferase 1 OS=Dianthus caryophyllus GN=GST1 PE=2 SV=1 4 169 1.0E-07
sp|P57108|GSTZ_EUPES Glutathione S-transferase zeta class OS=Euphorbia esula PE=2 SV=1 4 164 1.0E-07
sp|Q9VG95|GSTD5_DROME Glutathione S-transferase D5 OS=Drosophila melanogaster GN=GstD5 PE=1 SV=2 17 191 2.0E-07
sp|P42761|GSTFA_ARATH Glutathione S-transferase F10 OS=Arabidopsis thaliana GN=GSTF10 PE=1 SV=3 39 163 2.0E-07
sp|Q96324|GSTFB_ARATH Glutathione S-transferase F11 OS=Arabidopsis thaliana GN=GSTF11 PE=2 SV=1 37 163 3.0E-07
sp|Q9FE46|GSTFC_ARATH Glutathione S-transferase F12 OS=Arabidopsis thaliana GN=GSTF12 PE=1 SV=1 1 168 4.0E-07
sp|O76483|GSTT7_ANOGA Glutathione S-transferase D7 OS=Anopheles gambiae GN=GstD7 PE=2 SV=1 5 165 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006749 glutathione metabolic process Yes
GO:0005515 protein binding Yes
GO:0043603 cellular amide metabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0006790 sulfur compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2058
MFGKIYSFMPNGRVFKILAAAKLNGLELRIAEYQHMVTNQTPEFLSKFPVGKVPAFEGSDGLCLAESDAIAQYVA
ESGPRSGQLLGRNPTNCAQIRQWISFTDGEVTPHVLDLVIWRVGLGLYNDETESRALAGMEKGLAVLEHHLHGRR
WLVGDELTLADLTLASALVWAFLHIIDGKMRDRFPDVSTWYLRTIGVEEVKDVFGPPNLISVRRVYSGEGLKSM
Coding >Ophio5|2058
ATGTTTGGAAAGATTTATTCGTTCATGCCGAACGGCAGGGTCTTTAAAATCCTCGCCGCGGCAAAACTCAACGGC
CTTGAACTGCGGATAGCCGAATACCAGCACATGGTGACGAACCAAACGCCTGAGTTTCTCTCCAAGTTCCCAGTC
GGAAAGGTGCCGGCCTTTGAGGGCTCCGACGGCCTCTGCCTTGCCGAGTCGGATGCCATCGCCCAGTATGTCGCC
GAGTCGGGCCCGCGTTCCGGGCAGCTTCTGGGACGAAACCCGACCAACTGCGCCCAAATCCGGCAGTGGATCTCC
TTTACCGACGGGGAGGTGACGCCTCACGTCCTCGACCTCGTCATCTGGCGGGTCGGTTTGGGCTTGTACAATGAC
GAGACCGAGTCTCGAGCTCTTGCTGGCATGGAAAAGGGGCTGGCTGTTCTGGAGCATCACCTGCATGGCCGAAGG
TGGCTGGTGGGCGACGAATTGACCCTTGCGGATCTGACGCTGGCCTCTGCCCTTGTCTGGGCCTTTCTTCATATC
ATAGACGGGAAGATGAGGGACAGGTTTCCCGATGTGAGCACTTGGTATCTGAGAACCATTGGTGTCGAAGAGGTC
AAGGATGTGTTTGGTCCGCCGAATTTGATCTCGGTAAGGCGTGTCTACTCAGGAGAAGGGTTGAAATCTATG
Transcript >Ophio5|2058
ATGTTTGGAAAGATTTATTCGTTCATGCCGAACGGCAGGGTCTTTAAAATCCTCGCCGCGGCAAAACTCAACGGC
CTTGAACTGCGGATAGCCGAATACCAGCACATGGTGACGAACCAAACGCCTGAGTTTCTCTCCAAGTTCCCAGTC
GGAAAGGTGCCGGCCTTTGAGGGCTCCGACGGCCTCTGCCTTGCCGAGTCGGATGCCATCGCCCAGTATGTCGCC
GAGTCGGGCCCGCGTTCCGGGCAGCTTCTGGGACGAAACCCGACCAACTGCGCCCAAATCCGGCAGTGGATCTCC
TTTACCGACGGGGAGGTGACGCCTCACGTCCTCGACCTCGTCATCTGGCGGGTCGGTTTGGGCTTGTACAATGAC
GAGACCGAGTCTCGAGCTCTTGCTGGCATGGAAAAGGGGCTGGCTGTTCTGGAGCATCACCTGCATGGCCGAAGG
TGGCTGGTGGGCGACGAATTGACCCTTGCGGATCTGACGCTGGCCTCTGCCCTTGTCTGGGCCTTTCTTCATATC
ATAGACGGGAAGATGAGGGACAGGTTTCCCGATGTGAGCACTTGGTATCTGAGAACCATTGGTGTCGAAGAGGTC
AAGGATGTGTTTGGTCCGCCGAATTTGATCTCGGTAAGGCGTGTCTACTCAGGAGAAGGGTTGAAATCTATGTAG
Gene >Ophio5|2058
ATGTTTGGAAAGATTTATTCGTTCATGCCGAACGGCAGGGTCTTTAAAGTAGAGAGGCAATGCGGTAACGGTAAC
GGGCCTCGGACGAAGTCTGCTGACAACTTCATCGTAGATCCTCGCCGCGGCAAAACTCAACGGCCTTGAACTGCG
GATAGCCGAATACCAGCACATGGTGACGAACCAAACGCCTGAGTTTCTCTCCAAGTTCCCAGTCGGAAAGGTGCC
GGCCTTTGAGGGCTCCGACGGCCTCTGCCTTGCCGAGTCGGATGCCATCGCCCAGTATGTCGCCGAGTCGGGCCC
GCGTTCCGGGCAGCTTCTGGGACGAAACCCGACCAACTGCGCCCAAATCCGGCAGTGGATCTCCTTTACCGACGG
GGAGGTGACGCCTCACGTCCTCGACCTCGTCATCTGGCGGGTCGGTTTGGGCTTGTACAATGACGAGACCGAGTC
TCGAGCTCTTGCTGGCATGGAAAAGGGGCTGGCTGTTCTGGAGCATCACCTGCATGGCCGAAGGTGGCTGGTGGG
CGACGAATTGACCCTTGCGGATCTGACGCTGGCCTCTGCCCTTGTCTGGGCCTTTCTTCATATCATAGACGGGAA
GATGAGGGACAGGTTTCCCGATGTGAGCACTTGGTATCTGAGAACCATTGGTGTCGAAGAGGTCAAGGATGTGTT
TGGTCCGCCGAATTTGATCTCGGTAAGGCGTGTCTACTCAGGAGAAGGGTTGAAATCTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail