Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2043
Gene name
Locationscaffold_181:19878..20391
Strand-
Gene length (bp)513
Transcript length (bp)513
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08636 Pkr1 ER protein Pkr1 4.4E-29 5 74

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03880|PKR1_YEAST V-type ATPase assembly factor PKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKR1 PE=1 SV=1 5 99 3.0E-12
sp|Q9P7Y3|PKR1_SCHPO V-type ATPase assembly factor pkr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkr1 PE=3 SV=1 5 89 4.0E-11

GO

GO Term Description Terminal node
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Yes
GO:0043933 protein-containing complex organization No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0070070 proton-transporting V-type ATPase complex assembly No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0065003 protein-containing complex assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2043
MASFFFVDLWNAIFTPGPTPTLLRATNITFACLQLVLGALLFTTASIHFVILSGLCASLWWSINWFVTELNAQQQ
QQQPQKQPQQQQQQKKRRRQDVEESSDTEVEPPPPLTDTAATKVESSGLAADLRLRSAAAARAHHQPPPLDGTQS
SVSTEDEWEKVSGSERSKES
Coding >Ophio5|2043
ATGGCGTCCTTCTTCTTCGTCGACCTTTGGAACGCCATCTTCACTCCCGGTCCCACGCCGACACTCCTACGAGCC
ACCAACATCACCTTCGCCTGCCTGCAGCTCGTCCTCGGCGCCCTCCTCTTCACCACGGCGAGCATCCACTTTGTC
ATCCTCTCCGGTCTATGCGCCTCGCTCTGGTGGTCCATCAACTGGTTCGTCACCGAGCTGAATGCCCAACAGCAA
CAACAACAACCACAAAAACAACCACAACAACAACAACAACAAAAGAAGAGAAGGCGCCAAGACGTAGAGGAAAGC
AGCGATACAGAGGTCGAACCACCACCTCCCTTGACCGACACGGCTGCTACAAAGGTCGAGTCTTCGGGCCTGGCT
GCCGACTTACGTCTTAGGTCGGCTGCTGCTGCTCGTGCGCATCATCAACCACCTCCGCTTGATGGAACGCAGTCG
AGTGTTAGCACCGAGGATGAGTGGGAGAAGGTCTCGGGTAGTGAGAGGAGTAAGGAGAGT
Transcript >Ophio5|2043
ATGGCGTCCTTCTTCTTCGTCGACCTTTGGAACGCCATCTTCACTCCCGGTCCCACGCCGACACTCCTACGAGCC
ACCAACATCACCTTCGCCTGCCTGCAGCTCGTCCTCGGCGCCCTCCTCTTCACCACGGCGAGCATCCACTTTGTC
ATCCTCTCCGGTCTATGCGCCTCGCTCTGGTGGTCCATCAACTGGTTCGTCACCGAGCTGAATGCCCAACAGCAA
CAACAACAACCACAAAAACAACCACAACAACAACAACAACAAAAGAAGAGAAGGCGCCAAGACGTAGAGGAAAGC
AGCGATACAGAGGTCGAACCACCACCTCCCTTGACCGACACGGCTGCTACAAAGGTCGAGTCTTCGGGCCTGGCT
GCCGACTTACGTCTTAGGTCGGCTGCTGCTGCTCGTGCGCATCATCAACCACCTCCGCTTGATGGAACGCAGTCG
AGTGTTAGCACCGAGGATGAGTGGGAGAAGGTCTCGGGTAGTGAGAGGAGTAAGGAGAGTTGA
Gene >Ophio5|2043
ATGGCGTCCTTCTTCTTCGTCGACCTTTGGAACGCCATCTTCACTCCCGGTCCCACGCCGACACTCCTACGAGCC
ACCAACATCACCTTCGCCTGCCTGCAGCTCGTCCTCGGCGCCCTCCTCTTCACCACGGCGAGCATCCACTTTGTC
ATCCTCTCCGGTCTATGCGCCTCGCTCTGGTGGTCCATCAACTGGTTCGTCACCGAGCTGAATGCCCAACAGCAA
CAACAACAACCACAAAAACAACCACAACAACAACAACAACAAAAGAAGAGAAGGCGCCAAGACGTAGAGGAAAGC
AGCGATACAGAGGTCGAACCACCACCTCCCTTGACCGACACGGCTGCTACAAAGGTCGAGTCTTCGGGCCTGGCT
GCCGACTTACGTCTTAGGTCGGCTGCTGCTGCTCGTGCGCATCATCAACCACCTCCGCTTGATGGAACGCAGTCG
AGTGTTAGCACCGAGGATGAGTGGGAGAAGGTCTCGGGTAGTGAGAGGAGTAAGGAGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail