Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2032
Gene name
Locationscaffold_180:21861..24707
Strand+
Gene length (bp)2846
Transcript length (bp)2676
Coding sequence length (bp)2673
Protein length (aa) 891

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 2.7E-13 52 129
PF01822 WSC WSC domain 2.1E-15 162 242
PF01822 WSC WSC domain 6.1E-18 271 355
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 1.7E-26 437 637
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 1.2E-20 775 870

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 32 891 0.0E+00
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 45 250 1.0E-27
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 17 241 9.0E-27
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 162 364 1.0E-20
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 137 362 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 32 891 0.0E+00
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 45 250 1.0E-27
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 17 241 9.0E-27
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 162 364 1.0E-20
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 137 362 5.0E-18
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 52 248 8.0E-18
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 151 362 9.0E-18
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 163 325 4.0E-15
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 163 325 4.0E-13
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 163 362 2.0E-12
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 17 138 4.0E-12
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 163 325 4.0E-12
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 163 362 4.0E-12
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 250 362 7.0E-11
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 163 325 7.0E-11
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 47 201 7.0E-10
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 271 362 3.0E-09
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 47 138 9.0E-09
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 271 362 9.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 250 362 5.0E-08
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 53 212 1.0E-07
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 53 138 3.0E-07
sp|Q99N43|KREM1_MOUSE Kremen protein 1 OS=Mus musculus GN=Kremen1 PE=2 SV=2 163 251 4.0E-07
sp|Q96MU8|KREM1_HUMAN Kremen protein 1 OS=Homo sapiens GN=KREMEN1 PE=2 SV=3 163 251 4.0E-07
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 273 362 8.0E-07
sp|Q924S4|KREM1_RAT Kremen protein 1 OS=Rattus norvegicus GN=Kremen1 PE=2 SV=1 163 251 8.0E-07
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 53 251 1.0E-06
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 53 138 3.0E-06
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 53 251 4.0E-06
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 32 138 4.0E-06
sp|Q5QQ52|XYLT_CAEBR Xylosyltransferase sqv-6 OS=Caenorhabditis briggsae GN=sqv-6 PE=2 SV=1 103 264 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2032
MKGPPNFSALILLCALSLCHGAPTSTSESATATTMPRACPGQPDTVGNWMSYGCYSEASDGRTLRDKTYADDNMT
LAACGSFCVEYSFFGIEYARECYCGDTLDPTATKRQGSECSMTCMGSAGCEYCGAGRRLSVYNNTRKGPTGTALP
EPTELPDGWASYGCWIDGVHGRILKEQVPDDAKLTLQSCAKTCAGLGFTIAGAEYSRQCFCGNQIVNGGARAKSV
SECNAACAGDRRQKCGGPARMSILSTGPPRVIAEPRIVPRLGDWAYHGCVQDNVNQRRTFFWQNFFDGNLTVETC
LERCGNFKYAAAGLQYGRECYCGDPENINRAGAKLVDDKECNVPCTGNETALCGGGTRLTTYFWKGDDPLYAWDF
PEAGSPEAGSYDLLIGGVCVPLMTSQAITGKVTFLEKWGTGPPNSTGAYELDLSLVDNNPKAAWRTMHVKTDIFC
AGGLTLPDKAGRQLNVGGWSGSSTYGVRLYTPDGSVGVPGKNDWQEDVNVLKLQNGRWYPSAMIMANGSILVIGG
EVGSNSAAVPTLEILPPTGTKPIYMEWLERTNPNNLYPYVCVLPSGGIFVAYWNEARILDETTFATIKTLPNIPG
AVNDPKGGRTYPLEGAAVLLPQRAPYNEPLGVLICGGSTNGPSNAIDNCVLTYPDDADAKWTIERMPSPRVMPCM
APLPDGTYMILNGARHGVAGFGLGKDPNLNALLYDPAKPVGRRITVMANTTVARLYHSEAITLLDGRVLVSGSDP
QDGVNPQEYRVETFTPPYLLRGKPRPTFTLEKTDWSHGQQLSFSLGGPAQNGDLAVSLLGSVSSTHGNSMGARTI
FPDFSCSGTSCSVTAPPNKYICPPGWYQFFVLDGGVPAVGVFVRIGGDPARVGLWPKGNGFTTPGI
Coding >Ophio5|2032
ATGAAGGGCCCTCCCAACTTCTCCGCACTTATACTCCTGTGTGCCCTATCATTGTGTCATGGCGCTCCTACGAGC
ACAAGCGAATCTGCGACGGCGACGACCATGCCCAGGGCTTGCCCTGGCCAGCCGGACACTGTGGGCAACTGGATG
TCGTACGGCTGCTATTCCGAGGCGTCTGATGGTCGCACTCTGCGGGACAAGACGTACGCCGACGATAACATGACG
CTGGCTGCATGCGGTAGCTTCTGTGTCGAATACTCCTTCTTCGGCATCGAATATGCGCGAGAATGCTACTGTGGC
GACACACTCGACCCGACCGCCACCAAGCGGCAGGGCTCAGAGTGCTCCATGACTTGCATGGGATCGGCCGGCTGT
GAGTACTGCGGCGCCGGCCGTCGGCTGTCCGTCTACAACAACACTCGAAAGGGGCCGACGGGAACGGCTCTCCCT
GAGCCGACGGAACTGCCCGATGGCTGGGCTTCGTACGGGTGCTGGATCGACGGTGTCCACGGTCGGATCCTCAAG
GAACAAGTGCCCGACGACGCGAAACTGACGCTCCAGTCCTGCGCCAAGACGTGTGCCGGCCTCGGATTCACCATT
GCCGGCGCAGAGTATTCGCGCCAGTGCTTCTGTGGCAACCAAATCGTCAACGGCGGCGCCCGGGCCAAGTCGGTA
TCGGAGTGTAACGCGGCCTGCGCCGGAGACAGGCGTCAAAAGTGCGGCGGTCCGGCCCGGATGAGCATCCTCTCG
ACCGGTCCGCCCCGGGTCATCGCCGAACCGCGGATCGTGCCCCGGTTGGGTGACTGGGCCTACCACGGCTGCGTC
CAGGACAACGTCAATCAGAGGCGCACCTTTTTCTGGCAAAACTTCTTCGACGGCAACCTGACGGTCGAGACCTGT
CTCGAGAGGTGCGGCAACTTCAAGTACGCCGCCGCCGGCCTCCAGTACGGCCGGGAGTGCTATTGCGGCGACCCG
GAGAACATCAACAGGGCCGGAGCCAAGTTGGTGGATGACAAGGAGTGCAACGTGCCCTGTACCGGCAACGAAACC
GCCCTCTGCGGAGGCGGCACTCGGCTCACGACGTATTTCTGGAAGGGCGACGACCCCTTATACGCTTGGGACTTC
CCCGAGGCCGGCTCCCCGGAGGCCGGCTCGTACGACTTGCTCATCGGCGGCGTCTGCGTGCCGCTCATGACGTCG
CAGGCCATCACCGGAAAGGTGACCTTCCTGGAGAAATGGGGAACCGGCCCTCCCAACTCGACGGGGGCCTACGAG
CTCGATCTCTCCCTTGTCGACAATAATCCCAAGGCCGCGTGGCGGACCATGCACGTCAAGACGGACATCTTCTGC
GCCGGAGGACTCACCCTTCCGGACAAGGCCGGCCGGCAGCTCAACGTCGGCGGCTGGTCCGGCTCTTCGACCTAC
GGCGTCCGGCTCTACACGCCAGACGGATCGGTCGGCGTGCCCGGCAAAAACGACTGGCAGGAGGACGTCAACGTG
CTCAAGCTGCAAAACGGACGCTGGTATCCGTCGGCCATGATCATGGCCAACGGTTCCATTCTCGTCATCGGCGGC
GAGGTCGGCTCTAACAGCGCGGCGGTGCCGACTCTCGAGATCTTGCCGCCGACCGGCACCAAGCCCATTTACATG
GAGTGGCTAGAGCGCACGAATCCGAACAATCTGTATCCATACGTGTGCGTCTTGCCATCTGGCGGCATCTTCGTC
GCCTACTGGAACGAGGCCCGGATCCTGGATGAGACGACGTTTGCCACTATCAAGACGCTCCCCAACATACCCGGT
GCCGTCAACGACCCCAAAGGCGGCCGCACCTATCCGCTCGAGGGCGCGGCCGTCTTGCTTCCGCAACGCGCCCCC
TACAACGAGCCTCTCGGGGTCCTCATCTGTGGCGGCTCGACCAACGGCCCATCCAACGCCATAGACAACTGCGTC
TTGACGTATCCAGATGACGCCGATGCCAAGTGGACCATCGAGCGCATGCCCTCCCCTCGCGTCATGCCATGCATG
GCCCCTTTACCGGACGGGACTTACATGATTCTCAACGGCGCTCGCCATGGCGTCGCCGGCTTCGGTCTCGGCAAA
GATCCCAATCTTAACGCGCTTCTGTACGACCCAGCCAAGCCGGTCGGACGCCGCATCACCGTCATGGCCAACACG
ACGGTCGCTCGCCTGTACCACTCGGAGGCCATCACTCTCCTCGACGGCCGCGTGCTCGTATCTGGGTCAGATCCC
CAGGACGGCGTCAACCCGCAAGAATACCGCGTCGAGACATTCACGCCCCCTTACCTCCTCAGGGGCAAGCCGCGA
CCTACCTTTACGCTCGAGAAGACGGACTGGTCGCACGGACAGCAGCTTTCCTTCAGCCTCGGCGGCCCCGCCCAG
AACGGCGACCTGGCCGTCTCCCTGCTCGGCTCCGTCTCCAGCACCCACGGAAACTCGATGGGCGCCCGCACTATC
TTTCCCGACTTCTCCTGCTCGGGCACGTCCTGCTCCGTCACGGCGCCGCCAAACAAGTACATCTGTCCGCCGGGG
TGGTACCAGTTCTTTGTCTTGGATGGCGGTGTTCCTGCCGTTGGCGTCTTTGTCCGTATCGGTGGCGATCCCGCT
CGGGTCGGGCTGTGGCCGAAAGGAAACGGCTTTACCACCCCCGGCATC
Transcript >Ophio5|2032
ATGAAGGGCCCTCCCAACTTCTCCGCACTTATACTCCTGTGTGCCCTATCATTGTGTCATGGCGCTCCTACGAGC
ACAAGCGAATCTGCGACGGCGACGACCATGCCCAGGGCTTGCCCTGGCCAGCCGGACACTGTGGGCAACTGGATG
TCGTACGGCTGCTATTCCGAGGCGTCTGATGGTCGCACTCTGCGGGACAAGACGTACGCCGACGATAACATGACG
CTGGCTGCATGCGGTAGCTTCTGTGTCGAATACTCCTTCTTCGGCATCGAATATGCGCGAGAATGCTACTGTGGC
GACACACTCGACCCGACCGCCACCAAGCGGCAGGGCTCAGAGTGCTCCATGACTTGCATGGGATCGGCCGGCTGT
GAGTACTGCGGCGCCGGCCGTCGGCTGTCCGTCTACAACAACACTCGAAAGGGGCCGACGGGAACGGCTCTCCCT
GAGCCGACGGAACTGCCCGATGGCTGGGCTTCGTACGGGTGCTGGATCGACGGTGTCCACGGTCGGATCCTCAAG
GAACAAGTGCCCGACGACGCGAAACTGACGCTCCAGTCCTGCGCCAAGACGTGTGCCGGCCTCGGATTCACCATT
GCCGGCGCAGAGTATTCGCGCCAGTGCTTCTGTGGCAACCAAATCGTCAACGGCGGCGCCCGGGCCAAGTCGGTA
TCGGAGTGTAACGCGGCCTGCGCCGGAGACAGGCGTCAAAAGTGCGGCGGTCCGGCCCGGATGAGCATCCTCTCG
ACCGGTCCGCCCCGGGTCATCGCCGAACCGCGGATCGTGCCCCGGTTGGGTGACTGGGCCTACCACGGCTGCGTC
CAGGACAACGTCAATCAGAGGCGCACCTTTTTCTGGCAAAACTTCTTCGACGGCAACCTGACGGTCGAGACCTGT
CTCGAGAGGTGCGGCAACTTCAAGTACGCCGCCGCCGGCCTCCAGTACGGCCGGGAGTGCTATTGCGGCGACCCG
GAGAACATCAACAGGGCCGGAGCCAAGTTGGTGGATGACAAGGAGTGCAACGTGCCCTGTACCGGCAACGAAACC
GCCCTCTGCGGAGGCGGCACTCGGCTCACGACGTATTTCTGGAAGGGCGACGACCCCTTATACGCTTGGGACTTC
CCCGAGGCCGGCTCCCCGGAGGCCGGCTCGTACGACTTGCTCATCGGCGGCGTCTGCGTGCCGCTCATGACGTCG
CAGGCCATCACCGGAAAGGTGACCTTCCTGGAGAAATGGGGAACCGGCCCTCCCAACTCGACGGGGGCCTACGAG
CTCGATCTCTCCCTTGTCGACAATAATCCCAAGGCCGCGTGGCGGACCATGCACGTCAAGACGGACATCTTCTGC
GCCGGAGGACTCACCCTTCCGGACAAGGCCGGCCGGCAGCTCAACGTCGGCGGCTGGTCCGGCTCTTCGACCTAC
GGCGTCCGGCTCTACACGCCAGACGGATCGGTCGGCGTGCCCGGCAAAAACGACTGGCAGGAGGACGTCAACGTG
CTCAAGCTGCAAAACGGACGCTGGTATCCGTCGGCCATGATCATGGCCAACGGTTCCATTCTCGTCATCGGCGGC
GAGGTCGGCTCTAACAGCGCGGCGGTGCCGACTCTCGAGATCTTGCCGCCGACCGGCACCAAGCCCATTTACATG
GAGTGGCTAGAGCGCACGAATCCGAACAATCTGTATCCATACGTGTGCGTCTTGCCATCTGGCGGCATCTTCGTC
GCCTACTGGAACGAGGCCCGGATCCTGGATGAGACGACGTTTGCCACTATCAAGACGCTCCCCAACATACCCGGT
GCCGTCAACGACCCCAAAGGCGGCCGCACCTATCCGCTCGAGGGCGCGGCCGTCTTGCTTCCGCAACGCGCCCCC
TACAACGAGCCTCTCGGGGTCCTCATCTGTGGCGGCTCGACCAACGGCCCATCCAACGCCATAGACAACTGCGTC
TTGACGTATCCAGATGACGCCGATGCCAAGTGGACCATCGAGCGCATGCCCTCCCCTCGCGTCATGCCATGCATG
GCCCCTTTACCGGACGGGACTTACATGATTCTCAACGGCGCTCGCCATGGCGTCGCCGGCTTCGGTCTCGGCAAA
GATCCCAATCTTAACGCGCTTCTGTACGACCCAGCCAAGCCGGTCGGACGCCGCATCACCGTCATGGCCAACACG
ACGGTCGCTCGCCTGTACCACTCGGAGGCCATCACTCTCCTCGACGGCCGCGTGCTCGTATCTGGGTCAGATCCC
CAGGACGGCGTCAACCCGCAAGAATACCGCGTCGAGACATTCACGCCCCCTTACCTCCTCAGGGGCAAGCCGCGA
CCTACCTTTACGCTCGAGAAGACGGACTGGTCGCACGGACAGCAGCTTTCCTTCAGCCTCGGCGGCCCCGCCCAG
AACGGCGACCTGGCCGTCTCCCTGCTCGGCTCCGTCTCCAGCACCCACGGAAACTCGATGGGCGCCCGCACTATC
TTTCCCGACTTCTCCTGCTCGGGCACGTCCTGCTCCGTCACGGCGCCGCCAAACAAGTACATCTGTCCGCCGGGG
TGGTACCAGTTCTTTGTCTTGGATGGCGGTGTTCCTGCCGTTGGCGTCTTTGTCCGTATCGGTGGCGATCCCGCT
CGGGTCGGGCTGTGGCCGAAAGGAAACGGCTTTACCACCCCCGGCATCTAG
Gene >Ophio5|2032
ATGAAGGGCCCTCCCAACTTCTCCGCACTTATACTCCTGTGTGCCCTATCATTGTGTCATGGCGCTCCTACGAGC
ACAAGGTTAGCAGTTTCAGTCTTCCCCCCCCCCCCCCCCATTCCTCGGTAGTACACAATACGCTCATCTGAACGG
CAGCGAATCTGCGACGGCGACGACCATGCCCAGGGCTTGCCCTGGCCAGCCGGACACTGTGGGCAACTGGATGTC
GTACGGCTGCTATTCCGAGGCGTCTGATGGTCGCACTCTGCGGGACAAGACGTACGCCGACGATAACATGACGCT
GGCTGCATGCGGTAGCTTCTGTGTCGAATACTCCTTCTTCGGCATCGAATATGCGCGAGAATGCTACTGTGGCGA
CACACTCGACCCGACCGCCACCAAGCGGCAGGGCTCAGAGTGCTCCATGACTTGCATGGGATCGGCCGGCTGTGA
GTACTGCGGCGCCGGCCGTCGGCTGTCCGTCTACAACAACACTCGAAAGGGGCCGACGGGAACGGCTCTCCCTGA
GCCGACGGAACTGCCCGATGGCTGGGCTTCGTACGGGTGCTGGATCGACGGTGTCCACGGTCGGATCCTCAAGGA
ACAAGTGCCCGACGACGCGAAACTGACGCTCCAGTCCTGCGCCAAGACGTGTGCCGGCCTCGGATTCACCATTGC
CGGCGCAGAGTATTCGCGCCAGTGCTTCTGTGGCAACCAAATCGTCAACGGCGGCGCCCGGGCCAAGTCGGTATC
GGAGTGTAACGCGGCCTGCGCCGGAGACAGGCGTCAAAAGTGCGGCGGTCCGGCCCGGATGAGCATCCTCTCGAC
CGGTCCGCCCCGGGTCATCGCCGAACCGCGGATCGTGCCCCGGTTGGGTGACTGGGCCTACCACGGCTGCGTCCA
GGACAACGTCAATCAGAGGCGCACCTTTTTCTGGCAAAACTTCTTCGACGGCAACCTGACGGTCGAGACCTGTCT
CGAGAGGTGCGGCAACTTCAAGTACGCCGCCGCCGGCCTCCAGTACGGCCGGGAGTGCTATTGCGGCGACCCGGA
GAACATCAACAGGGCCGGAGCCAAGTTGGTGGATGACAAGGAGTGCAACGTGCCCTGTACCGGCAACGAAACCGC
CCTCTGCGGAGGCGGCACTCGGCTCACGACGTATTTCTGGAAGGGCGACGACCCCTTATACGCTTGGGACTTCCC
CGAGGCCGGCTCCCCGGAGGCCGGCTCGTACGACTTGCTCATCGGCGGCGTCTGCGTGCCGCTCATGACGTCGCA
GGCCATCACCGGAAAGGTGACCTTCCTGGAGAAATGGGGAACCGGCCCTCCCAACTCGACGGGGGCCTACGAGCT
CGATCTCTCCCTTGTCGACAATAATCCCAAGGCCGCGTGGCGGACCATGCACGTCAAGACGGACATCTTCTGCGC
CGGAGGACTCACCCTTCCGGACAAGGCCGGCCGGCAGCTCAACGTCGGCGGCTGGTCCGGCTCTTCGACCTACGG
CGTCCGGCTCTACACGCCAGACGGATCGGTCGGCGTGCCCGGCAAAAACGACTGGCAGGAGGACGTCAACGTGCT
CAAGCTGCAAAACGGACGCTGGTATCCGTCGGCCATGATCATGGCCAACGGTTCCATTCTCGTCATCGGCGGCGA
GGTCGGCTCTAACAGCGCGGCGGTGCCGACTCTCGAGATCTTGCCGCCGACCGGCACCAAGCCCATTTACATGGA
GTGGCTAGAGCGCACGAATCCGAACAATCTGTATCCATACGTGTGCGTCTTGCCATCTGGCGGCATCTTCGTCGC
CTACTGGAACGAGGCCCGGATCCTGGATGAGACGACGTTTGCCACTATCAAGACGCTGTCAGTATTCCTCCCGAG
AGGTATTATACTACTATAACATACCTGACTGACTCACTCTTCCTCTCTCTCCCTATCTCTCCCTTTTTCTTCTCC
AAAGCCCCAACATACCCGGTGCCGTCAACGACCCCAAAGGCGGCCGCACCTATCCGCTCGAGGGCGCGGCCGTCT
TGCTTCCGCAACGCGCCCCCTACAACGAGCCTCTCGGGGTCCTCATCTGTGGCGGCTCGACCAACGGCCCATCCA
ACGCCATAGACAACTGCGTCTTGACGTATCCAGATGACGCCGATGCCAAGTGGACCATCGAGCGCATGCCCTCCC
CTCGCGTCATGCCATGCATGGCCCCTTTACCGGACGGGACTTACATGATTCTCAACGGCGCTCGCCATGGCGTCG
CCGGCTTCGGTCTCGGCAAAGATCCCAATCTTAACGCGCTTCTGTACGACCCAGCCAAGCCGGTCGGACGCCGCA
TCACCGTCATGGCCAACACGACGGTCGCTCGCCTGTACCACTCGGAGGCCATCACTCTCCTCGACGGCCGCGTGC
TCGTATCTGGGTCAGATCCCCAGGACGGCGTCAACCCGCAAGAATACCGCGTCGAGACATTCACGCCCCCTTACC
TCCTCAGGGGCAAGCCGCGACCTACCTTTACGCTCGAGAAGACGGACTGGTCGCACGGACAGCAGCTTTCCTTCA
GCCTCGGCGGCCCCGCCCAGAACGGCGACCTGGCCGTCTCCCTGCTCGGCTCCGTCTCCAGCACCCACGGAAACT
CGATGGGCGCCCGCACTATCTTTCCCGACTTCTCCTGCTCGGGCACGTCCTGCTCCGTCACGGCGCCGCCAAACA
AGTACATCTGTCCGCCGGGGTGGTACCAGTTCTTTGTCTTGGATGGCGGTGTTCCTGCCGTTGGCGTCTTTGTCC
GTATCGGTGGCGATCCCGCTCGGGTCGGGCTGTGGCCGAAAGGAAACGGCTTTACCACCCCCGGCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail