Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2025
Gene name
Locationscaffold_180:5453..6726
Strand-
Gene length (bp)1273
Transcript length (bp)1221
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03124 EXS EXS family 6.4E-108 18 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD8|ERD11_SCHPO Protein ERD1 homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erd1 PE=3 SV=2 6 391 4.0E-35
sp|Q10151|ERD12_SCHPO Protein ERD1 homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1D4.05c PE=3 SV=1 152 377 1.0E-34
sp|Q54G02|SPXS5_DICDI SPX and EXS domain-containing protein 5 OS=Dictyostelium discoideum GN=DDB_G0290647 PE=3 SV=2 66 404 4.0E-26
sp|Q55B06|SPXS1_DICDI SPX and EXS domain-containing protein 1 OS=Dictyostelium discoideum GN=DDB_G0271664 PE=3 SV=2 8 390 2.0E-22
sp|P41771|ERD1_KLULA Protein ERD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERD1 PE=3 SV=1 155 391 7.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD8|ERD11_SCHPO Protein ERD1 homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erd1 PE=3 SV=2 6 391 4.0E-35
sp|Q10151|ERD12_SCHPO Protein ERD1 homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1D4.05c PE=3 SV=1 152 377 1.0E-34
sp|Q54G02|SPXS5_DICDI SPX and EXS domain-containing protein 5 OS=Dictyostelium discoideum GN=DDB_G0290647 PE=3 SV=2 66 404 4.0E-26
sp|Q55B06|SPXS1_DICDI SPX and EXS domain-containing protein 1 OS=Dictyostelium discoideum GN=DDB_G0271664 PE=3 SV=2 8 390 2.0E-22
sp|P41771|ERD1_KLULA Protein ERD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERD1 PE=3 SV=1 155 391 7.0E-22
sp|A8DZH4|XPR1_DANRE Xenotropic and polytropic retrovirus receptor 1 homolog OS=Danio rerio GN=xpr1 PE=3 SV=1 60 402 1.0E-18
sp|Q6DD44|XPR1_XENLA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus laevis GN=xpr1 PE=2 SV=1 110 406 2.0E-18
sp|A7XZ53|XPR1_MUSPA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus pahari GN=Xpr1 PE=1 SV=1 60 402 4.0E-18
sp|Q28CY9|XPR1_XENTR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus tropicalis GN=xpr1 PE=2 SV=1 110 406 6.0E-18
sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens GN=XPR1 PE=1 SV=1 60 406 8.0E-18
sp|Q9TU72|XPR1_NEOVI Xenotropic and polytropic retrovirus receptor 1 OS=Neovison vison GN=XPR1 PE=2 SV=1 60 406 8.0E-18
sp|Q9QZ71|XPR1_MUSTR Xenotropic and polytropic retrovirus receptor 1 OS=Mus terricolor GN=Xpr1 PE=1 SV=1 60 402 2.0E-17
sp|Q9R032|XPR1_MUSSP Xenotropic and polytropic retrovirus receptor 1 OS=Mus spretus GN=Xpr1 PE=1 SV=1 60 402 5.0E-17
sp|Q9Z0U0|XPR1_MOUSE Xenotropic and polytropic retrovirus receptor 1 OS=Mus musculus GN=Xpr1 PE=1 SV=1 60 402 7.0E-17
sp|Q9QZ70|XPR1_CRIGR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Cricetulus griseus GN=XPR1 PE=2 SV=1 60 402 1.0E-16
sp|Q9R031|XPR1_MUSMC Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus musculus castaneus GN=Xpr1 PE=2 SV=1 60 402 1.0E-15
sp|Q54MJ9|SPXS3_DICDI SPX and EXS domain-containing protein 3 OS=Dictyostelium discoideum GN=xpr1 PE=3 SV=1 22 382 3.0E-15
sp|P40528|SYG1_YEAST Protein SYG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYG1 PE=1 SV=1 83 382 3.0E-15
sp|Q6K991|PHO12_ORYSJ Phosphate transporter PHO1-2 OS=Oryza sativa subsp. japonica GN=PHO1-2 PE=2 SV=1 27 382 2.0E-13
sp|Q8S403|PHO1_ARATH Phosphate transporter PHO1 OS=Arabidopsis thaliana GN=PHO1 PE=2 SV=1 10 382 8.0E-13
sp|Q6R8G8|PHO12_ARATH Phosphate transporter PHO1 homolog 2 OS=Arabidopsis thaliana GN=PHO1-H2 PE=2 SV=2 154 406 8.0E-13
sp|Q6R8G7|PHO13_ARATH Phosphate transporter PHO1 homolog 3 OS=Arabidopsis thaliana GN=PHO1;H3 PE=2 SV=2 7 406 1.0E-12
sp|Q6R8G2|PHO18_ARATH Phosphate transporter PHO1 homolog 8 OS=Arabidopsis thaliana GN=PHO1-H8 PE=2 SV=1 17 382 2.0E-12
sp|Q9UU86|SYG1_SCHPO Protein SYG1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.07c PE=3 SV=1 110 382 2.0E-12
sp|Q54HI2|SPXS4_DICDI SPX and EXS domain-containing protein 4 OS=Dictyostelium discoideum GN=DDB_G0289423 PE=3 SV=1 105 392 6.0E-12
sp|Q6R8G3|PHO17_ARATH Phosphate transporter PHO1 homolog 7 OS=Arabidopsis thaliana GN=PHO1-H7 PE=2 SV=1 17 404 2.0E-11
sp|P16151|ERD1_YEAST Protein ERD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERD1 PE=1 SV=3 155 379 3.0E-11
sp|Q93ZF5|PHO11_ARATH Phosphate transporter PHO1 homolog 1 OS=Arabidopsis thaliana GN=PHO1-H1 PE=2 SV=1 154 383 1.0E-10
sp|Q9LJW0|PHO19_ARATH Phosphate transporter PHO1 homolog 9 OS=Arabidopsis thaliana GN=PHO1-H9 PE=2 SV=1 94 382 1.0E-09
sp|Q6R8G6|PHO14_ARATH Phosphate transporter PHO1 homolog 4 OS=Arabidopsis thaliana GN=PHO1-H4 PE=2 SV=1 154 382 1.0E-09
sp|Q6R8G0|PHO1A_ARATH Phosphate transporter PHO1 homolog 10 OS=Arabidopsis thaliana GN=PHO1-H10 PE=2 SV=1 91 382 6.0E-09
sp|Q6R8G5|PHO15_ARATH Phosphate transporter PHO1 homolog 5 OS=Arabidopsis thaliana GN=PHO1-H5 PE=2 SV=2 154 406 1.0E-08
sp|Q651J5|PHO13_ORYSJ Phosphate transporter PHO1-3 OS=Oryza sativa subsp. japonica GN=PHO1-3 PE=2 SV=1 271 402 2.0E-08
sp|Q657S5|PHO11_ORYSJ Phosphate transporter PHO1-1 OS=Oryza sativa subsp. japonica GN=PHO1-1 PE=2 SV=2 154 403 3.0E-08
sp|Q86HQ3|SPXS2_DICDI SPX and EXS domain-containing protein 2 OS=Dictyostelium discoideum GN=DDB_G0274481 PE=3 SV=1 151 399 1.0E-07
sp|Q6R8G4|PHO16_ARATH Phosphate transporter PHO1 homolog 6 OS=Arabidopsis thaliana GN=PHO1-H6 PE=2 SV=1 112 382 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 70 92 22
3 99 121 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2025
MDGDPAVEPQLDSFSLVFPLPYRVGFIVTLAVWAWGLNLQYLGLVKIDVPALIRYPGRTSPHHASHHVSTYRLAT
VLSSLFAISISLFWLLTWRVPARVVAYDWLPMSYLFASIVVFLVPHRGLPLAGRRRFLAMLRRVGVGGIAETNEG
KFGDILLADVLTSYAKVCGDLFVAVCMFLTPGGSSTDRPDRNCGGAVIVPLLMALPSLIRLRQCLIEYLRVRRAP
YKESTGWGGQHLANALKYSTAFPVIITSSLQRNLPGEAAKTALNRAWLAAVLVNSLYSFYWDVAKDWDMTLFSAR
WKRNSPYHAWGLRDRLIFRPVGLYYTVMVLDLALRCTWSMKLSPHLYRFSDFESGIFLIELLEVLRRWLWIFFRV
ETEWIRNSTTGVGVDDILLGDYQGKDDDDDD
Coding >Ophio5|2025
ATGGACGGCGATCCTGCAGTCGAACCGCAGCTCGACTCCTTCAGCCTCGTCTTCCCGCTACCGTACCGCGTCGGC
TTCATCGTCACGCTCGCCGTTTGGGCATGGGGCCTGAACCTGCAATACCTCGGCCTCGTCAAGATTGACGTGCCG
GCGCTGATACGATATCCGGGCCGGACGTCACCGCATCATGCCTCGCACCACGTCTCGACTTACCGACTCGCCACG
GTGCTGTCGTCCCTCTTCGCCATCTCCATCTCTCTCTTCTGGCTGCTGACGTGGCGCGTGCCGGCACGCGTCGTC
GCCTACGACTGGCTGCCCATGTCGTACCTCTTCGCCTCAATTGTCGTCTTCCTCGTGCCCCATCGCGGCCTTCCG
CTGGCCGGACGACGGCGCTTCCTCGCCATGCTGCGCCGCGTCGGCGTCGGCGGCATTGCCGAGACGAACGAGGGC
AAGTTTGGGGATATCTTGCTGGCTGATGTTCTGACGTCGTATGCCAAGGTCTGTGGCGACCTCTTTGTCGCCGTC
TGTATGTTCCTCACCCCCGGCGGCTCCTCGACCGATCGGCCGGACCGTAACTGCGGGGGCGCCGTCATCGTGCCG
CTACTCATGGCTCTGCCCAGCTTGATCCGGCTCAGGCAGTGCTTGATCGAGTATCTGCGCGTCCGTCGGGCGCCC
TACAAGGAGTCGACGGGCTGGGGCGGGCAGCATCTGGCCAACGCGCTCAAGTACTCGACGGCCTTTCCCGTCATC
ATCACGAGTTCGTTGCAGAGGAACTTGCCAGGCGAGGCGGCCAAGACTGCCCTCAACAGGGCGTGGCTGGCTGCT
GTCCTGGTCAACTCGCTCTATTCCTTTTACTGGGACGTGGCCAAGGACTGGGACATGACGCTCTTTTCTGCCCGC
TGGAAGCGCAACTCGCCCTACCACGCTTGGGGACTGCGGGATCGGCTCATCTTTCGCCCCGTCGGCCTCTACTAC
ACCGTCATGGTGCTCGATCTGGCGCTGCGCTGCACCTGGTCGATGAAGCTCAGCCCTCACCTCTACAGGTTCAGC
GACTTCGAGAGCGGCATCTTCTTGATCGAGCTGCTCGAGGTGCTGCGACGGTGGCTGTGGATCTTTTTCCGTGTC
GAGACGGAGTGGATCCGGAATTCGACTACCGGCGTCGGCGTCGACGATATTCTGCTCGGGGACTACCAAGGAAAG
GACGACGATGATGACGAT
Transcript >Ophio5|2025
ATGGACGGCGATCCTGCAGTCGAACCGCAGCTCGACTCCTTCAGCCTCGTCTTCCCGCTACCGTACCGCGTCGGC
TTCATCGTCACGCTCGCCGTTTGGGCATGGGGCCTGAACCTGCAATACCTCGGCCTCGTCAAGATTGACGTGCCG
GCGCTGATACGATATCCGGGCCGGACGTCACCGCATCATGCCTCGCACCACGTCTCGACTTACCGACTCGCCACG
GTGCTGTCGTCCCTCTTCGCCATCTCCATCTCTCTCTTCTGGCTGCTGACGTGGCGCGTGCCGGCACGCGTCGTC
GCCTACGACTGGCTGCCCATGTCGTACCTCTTCGCCTCAATTGTCGTCTTCCTCGTGCCCCATCGCGGCCTTCCG
CTGGCCGGACGACGGCGCTTCCTCGCCATGCTGCGCCGCGTCGGCGTCGGCGGCATTGCCGAGACGAACGAGGGC
AAGTTTGGGGATATCTTGCTGGCTGATGTTCTGACGTCGTATGCCAAGGTCTGTGGCGACCTCTTTGTCGCCGTC
TGTATGTTCCTCACCCCCGGCGGCTCCTCGACCGATCGGCCGGACCGTAACTGCGGGGGCGCCGTCATCGTGCCG
CTACTCATGGCTCTGCCCAGCTTGATCCGGCTCAGGCAGTGCTTGATCGAGTATCTGCGCGTCCGTCGGGCGCCC
TACAAGGAGTCGACGGGCTGGGGCGGGCAGCATCTGGCCAACGCGCTCAAGTACTCGACGGCCTTTCCCGTCATC
ATCACGAGTTCGTTGCAGAGGAACTTGCCAGGCGAGGCGGCCAAGACTGCCCTCAACAGGGCGTGGCTGGCTGCT
GTCCTGGTCAACTCGCTCTATTCCTTTTACTGGGACGTGGCCAAGGACTGGGACATGACGCTCTTTTCTGCCCGC
TGGAAGCGCAACTCGCCCTACCACGCTTGGGGACTGCGGGATCGGCTCATCTTTCGCCCCGTCGGCCTCTACTAC
ACCGTCATGGTGCTCGATCTGGCGCTGCGCTGCACCTGGTCGATGAAGCTCAGCCCTCACCTCTACAGGTTCAGC
GACTTCGAGAGCGGCATCTTCTTGATCGAGCTGCTCGAGGTGCTGCGACGGTGGCTGTGGATCTTTTTCCGTGTC
GAGACGGAGTGGATCCGGAATTCGACTACCGGCGTCGGCGTCGACGATATTCTGCTCGGGGACTACCAAGGAAAG
GACGACGATGATGACGATTAG
Gene >Ophio5|2025
ATGGACGGCGATCCTGCAGTCGAACCGCAGCTCGACTCCTTCAGCCTCGTCTTCCCGCTACCGTACCGCGTCGGC
TTCATCGTCACGCTCGGTCAGTTTCCGTACCTCTCCGGTCAACGACGCTCTGCTCACCTCTGCCGCAGCCGTTTG
GGCATGGGGCCTGAACCTGCAATACCTCGGCCTCGTCAAGATTGACGTGCCGGCGCTGATACGATATCCGGGCCG
GACGTCACCGCATCATGCCTCGCACCACGTCTCGACTTACCGACTCGCCACGGTGCTGTCGTCCCTCTTCGCCAT
CTCCATCTCTCTCTTCTGGCTGCTGACGTGGCGCGTGCCGGCACGCGTCGTCGCCTACGACTGGCTGCCCATGTC
GTACCTCTTCGCCTCAATTGTCGTCTTCCTCGTGCCCCATCGCGGCCTTCCGCTGGCCGGACGACGGCGCTTCCT
CGCCATGCTGCGCCGCGTCGGCGTCGGCGGCATTGCCGAGACGAACGAGGGCAAGTTTGGGGATATCTTGCTGGC
TGATGTTCTGACGTCGTATGCCAAGGTCTGTGGCGACCTCTTTGTCGCCGTCTGTATGTTCCTCACCCCCGGCGG
CTCCTCGACCGATCGGCCGGACCGTAACTGCGGGGGCGCCGTCATCGTGCCGCTACTCATGGCTCTGCCCAGCTT
GATCCGGCTCAGGCAGTGCTTGATCGAGTATCTGCGCGTCCGTCGGGCGCCCTACAAGGAGTCGACGGGCTGGGG
CGGGCAGCATCTGGCCAACGCGCTCAAGTACTCGACGGCCTTTCCCGTCATCATCACGAGTTCGTTGCAGAGGAA
CTTGCCAGGCGAGGCGGCCAAGACTGCCCTCAACAGGGCGTGGCTGGCTGCTGTCCTGGTCAACTCGCTCTATTC
CTTTTACTGGGACGTGGCCAAGGACTGGGACATGACGCTCTTTTCTGCCCGCTGGAAGCGCAACTCGCCCTACCA
CGCTTGGGGACTGCGGGATCGGCTCATCTTTCGCCCCGTCGGCCTCTACTACACCGTCATGGTGCTCGATCTGGC
GCTGCGCTGCACCTGGTCGATGAAGCTCAGCCCTCACCTCTACAGGTTCAGCGACTTCGAGAGCGGCATCTTCTT
GATCGAGCTGCTCGAGGTGCTGCGACGGTGGCTGTGGATCTTTTTCCGTGTCGAGACGGAGTGGATCCGGAATTC
GACTACCGGCGTCGGCGTCGACGATATTCTGCTCGGGGACTACCAAGGAAAGGACGACGATGATGACGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail