Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2017
Gene name
Locationscaffold_18:73957..74268
Strand-
Gene length (bp)311
Transcript length (bp)243
Coding sequence length (bp)240
Protein length (aa) 80

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 129.28 44.09 214.46
CcL In ants, during behavior modification 4.23 0.00 11.57
CcD In ants, recently dead 8.99 0.00 19.78

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.008428 yes
SC16a CcD 0.000286 yes
CcL CcD 0.328431 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2017
MKFLALTIAALASVVAASYEKECEPATYACSNEMGKPGWKVCNTSGKWEFAGYYPPKTHYEFNKENGSPYCLPDY
WKKEY
Coding >Ophio5|2017
ATGAAGTTCCTCGCCCTCACTATCGCGGCCCTGGCCTCCGTCGTCGCCGCTAGCTACGAGAAGGAGTGCGAGCCT
GCCACGTATGCCTGCTCCAACGAAATGGGCAAGCCTGGCTGGAAGGTCTGCAACACGAGTGGCAAGTGGGAGTTC
GCTGGCTACTATCCGCCCAAGACTCACTACGAGTTCAATAAGGAGAATGGCAGCCCCTACTGCCTTCCGGACTAC
TGGAAGAAGGAGTAC
Transcript >Ophio5|2017
ATGAAGTTCCTCGCCCTCACTATCGCGGCCCTGGCCTCCGTCGTCGCCGCTAGCTACGAGAAGGAGTGCGAGCCT
GCCACGTATGCCTGCTCCAACGAAATGGGCAAGCCTGGCTGGAAGGTCTGCAACACGAGTGGCAAGTGGGAGTTC
GCTGGCTACTATCCGCCCAAGACTCACTACGAGTTCAATAAGGAGAATGGCAGCCCCTACTGCCTTCCGGACTAC
TGGAAGAAGGAGTACTAA
Gene >Ophio5|2017
ATGAAGTTCCTCGCCCTCACTATCGCGGCCCTGGCCTCCGTCGTCGCCGCTAGCTACGAGAAGGAGTGCGAGCCT
GCCACGTATGCCTGCTCCAACGAAATGGGCAAGCCTGGCTGGAAGGTCTGCAACACGAGTGGCAAGTGGGAGGTG
AGTTTTCCTATCTCTTGACGATGCTTTCAAAATCTTGGCCTTAACTCTAACTGACGCTGCTTCAGTTCGCTGGCT
ACTATCCGCCCAAGACTCACTACGAGTTCAATAAGGAGAATGGCAGCCCCTACTGCCTTCCGGACTACTGGAAGA
AGGAGTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail