Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2012
Gene name
Locationscaffold_18:56265..58425
Strand+
Gene length (bp)2160
Transcript length (bp)1944
Coding sequence length (bp)1941
Protein length (aa) 647

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 2.7E-17 43 222

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 44 200 9.0E-09
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 44 163 8.0E-08
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 37 204 3.0E-07
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 36 200 1.0E-06
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 36 200 1.0E-06

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2012
MHIRRATILAFLWLQWPSISSTSGCFGSLCQSTKVTPLGGPSAYRVDRRDPKTIKAAGGFRAKGKDFSIYKHAEL
GSKNTAYVSTSQQAANGAEIFATPPPPKGLRSFKDYKGQYLYDIHPTSNFVDTELTLGPWSTHREYELLAAGGIP
FAQIKGWTHLPRGSDSLTSERKYVRNPDYDPARWEGQSWNKDPQYQLAGFTEGMDRLNDRAPKFHPHTREPYKQF
KDQSESGLETEGLKFIEQHGKVPGIASFEPCFGLGGRVKRDANDCWLRNKEVADIEVFTPDTNGEKDGLTSEALK
EESAVVDSAAEGELASLTDRLAESEFATVLQRLLLTDFLKGKKMSVSELRARFSGYQPLNKLAKPRALLRRLNGH
ALTVAVLGVWVKDVIEVFVSQITTAFDKFVTVTSIIPVVGCLTSSIARKDGVDGALCVVGDVLLFSPLWPFGIAV
HAFRFLSDIAGQKFKAIRMWHDVEEFQRVRRQDWEAVLKGIVGYFQSETFREEVLESEFNVERAGFAFAASQIVG
LLKTARESKRANETDQMHTEAALFNATVQVYETMCQPLFKRKVSMVKEKQQAAKTFVRQELVKFNNEFANRSKAM
FKGIIASPTPKMGSKDSEENQIDRVIRERLGKPISIDIQPRHLPGES
Coding >Ophio5|2012
ATGCACATTAGGCGAGCCACTATATTGGCCTTCCTGTGGCTCCAGTGGCCTAGCATTAGCAGTACTAGTGGCTGT
TTCGGCAGTCTTTGCCAGTCCACAAAGGTTACACCGCTAGGGGGGCCATCCGCCTATCGGGTCGATAGGAGAGAT
CCAAAGACAATCAAAGCAGCAGGAGGCTTTCGCGCCAAGGGGAAAGACTTTAGCATCTATAAGCATGCGGAACTC
GGTTCCAAGAACACAGCCTATGTCTCGACTTCGCAACAGGCTGCTAATGGCGCCGAAATCTTCGCGACGCCTCCT
CCACCGAAAGGCCTCCGCAGCTTCAAGGATTATAAGGGGCAGTACCTATACGACATACATCCCACTTCCAACTTT
GTCGATACCGAGTTGACGCTCGGGCCATGGTCGACACACCGCGAATATGAGCTGTTAGCGGCTGGTGGCATACCG
TTCGCCCAAATTAAGGGCTGGACACACCTCCCCAGAGGTAGTGATTCGCTAACATCGGAGAGGAAGTATGTGAGA
AATCCAGACTACGATCCAGCCAGGTGGGAAGGCCAGTCGTGGAACAAAGACCCGCAGTATCAACTAGCCGGCTTT
ACAGAGGGGATGGATCGGCTCAACGACCGCGCCCCCAAGTTCCATCCCCACACTCGAGAGCCTTACAAGCAGTTC
AAAGATCAGTCTGAGTCGGGACTTGAGACGGAAGGTTTGAAGTTTATCGAACAACACGGGAAAGTTCCTGGAATC
GCCAGCTTCGAGCCATGCTTCGGCCTCGGTGGACGAGTTAAACGTGATGCTAATGACTGTTGGCTAAGAAACAAA
GAAGTTGCCGATATCGAAGTTTTCACCCCAGATACTAACGGGGAAAAAGATGGACTGACCAGCGAGGCACTAAAA
GAAGAGTCAGCAGTCGTTGATTCCGCCGCAGAGGGAGAACTGGCATCCTTGACCGACAGATTGGCGGAAAGCGAG
TTTGCTACGGTCCTTCAGCGTCTCTTATTGACGGATTTTCTAAAGGGGAAGAAGATGTCAGTGTCCGAGCTCCGG
GCGAGATTCAGCGGCTACCAGCCGTTGAACAAGCTTGCGAAGCCCAGAGCCCTCTTGCGAAGGTTAAATGGACAT
GCTCTGACCGTTGCTGTCCTGGGCGTCTGGGTGAAGGATGTCATCGAAGTGTTCGTGAGTCAGATCACGACGGCC
TTTGACAAGTTTGTTACAGTGACGTCTATCATCCCCGTCGTCGGTTGCTTGACTTCGTCTATTGCGAGGAAGGAT
GGCGTCGATGGAGCCTTGTGCGTCGTCGGCGACGTCCTTCTGTTCTCTCCGTTATGGCCTTTCGGCATCGCAGTT
CATGCTTTCCGATTCCTTTCGGATATAGCCGGCCAGAAATTCAAAGCGATCAGGATGTGGCACGACGTAGAGGAG
TTTCAGCGGGTTCGGAGACAGGATTGGGAAGCCGTGCTAAAAGGAATCGTCGGTTACTTCCAGTCCGAAACGTTC
CGCGAGGAGGTTCTCGAGTCCGAGTTCAACGTGGAGAGAGCCGGATTTGCTTTTGCGGCGTCACAGATCGTCGGC
TTGCTCAAGACGGCCCGGGAGAGTAAGCGGGCGAACGAAACGGACCAGATGCATACCGAGGCGGCGCTATTCAAC
GCTACGGTTCAAGTTTACGAGACCATGTGCCAGCCTCTGTTCAAGCGCAAGGTCTCGATGGTGAAAGAGAAGCAG
CAAGCCGCTAAGACGTTTGTGAGACAGGAACTCGTCAAGTTTAATAACGAGTTTGCCAATAGAAGCAAGGCGATG
TTTAAAGGGATTATTGCATCACCGACACCAAAGATGGGATCTAAAGATAGTGAAGAGAATCAAATCGACCGGGTC
ATTAGGGAGAGGCTCGGGAAACCGATCTCGATCGATATACAGCCTCGTCACCTCCCGGGAGAGAGT
Transcript >Ophio5|2012
ATGCACATTAGGCGAGCCACTATATTGGCCTTCCTGTGGCTCCAGTGGCCTAGCATTAGCAGTACTAGTGGCTGT
TTCGGCAGTCTTTGCCAGTCCACAAAGGTTACACCGCTAGGGGGGCCATCCGCCTATCGGGTCGATAGGAGAGAT
CCAAAGACAATCAAAGCAGCAGGAGGCTTTCGCGCCAAGGGGAAAGACTTTAGCATCTATAAGCATGCGGAACTC
GGTTCCAAGAACACAGCCTATGTCTCGACTTCGCAACAGGCTGCTAATGGCGCCGAAATCTTCGCGACGCCTCCT
CCACCGAAAGGCCTCCGCAGCTTCAAGGATTATAAGGGGCAGTACCTATACGACATACATCCCACTTCCAACTTT
GTCGATACCGAGTTGACGCTCGGGCCATGGTCGACACACCGCGAATATGAGCTGTTAGCGGCTGGTGGCATACCG
TTCGCCCAAATTAAGGGCTGGACACACCTCCCCAGAGGTAGTGATTCGCTAACATCGGAGAGGAAGTATGTGAGA
AATCCAGACTACGATCCAGCCAGGTGGGAAGGCCAGTCGTGGAACAAAGACCCGCAGTATCAACTAGCCGGCTTT
ACAGAGGGGATGGATCGGCTCAACGACCGCGCCCCCAAGTTCCATCCCCACACTCGAGAGCCTTACAAGCAGTTC
AAAGATCAGTCTGAGTCGGGACTTGAGACGGAAGGTTTGAAGTTTATCGAACAACACGGGAAAGTTCCTGGAATC
GCCAGCTTCGAGCCATGCTTCGGCCTCGGTGGACGAGTTAAACGTGATGCTAATGACTGTTGGCTAAGAAACAAA
GAAGTTGCCGATATCGAAGTTTTCACCCCAGATACTAACGGGGAAAAAGATGGACTGACCAGCGAGGCACTAAAA
GAAGAGTCAGCAGTCGTTGATTCCGCCGCAGAGGGAGAACTGGCATCCTTGACCGACAGATTGGCGGAAAGCGAG
TTTGCTACGGTCCTTCAGCGTCTCTTATTGACGGATTTTCTAAAGGGGAAGAAGATGTCAGTGTCCGAGCTCCGG
GCGAGATTCAGCGGCTACCAGCCGTTGAACAAGCTTGCGAAGCCCAGAGCCCTCTTGCGAAGGTTAAATGGACAT
GCTCTGACCGTTGCTGTCCTGGGCGTCTGGGTGAAGGATGTCATCGAAGTGTTCGTGAGTCAGATCACGACGGCC
TTTGACAAGTTTGTTACAGTGACGTCTATCATCCCCGTCGTCGGTTGCTTGACTTCGTCTATTGCGAGGAAGGAT
GGCGTCGATGGAGCCTTGTGCGTCGTCGGCGACGTCCTTCTGTTCTCTCCGTTATGGCCTTTCGGCATCGCAGTT
CATGCTTTCCGATTCCTTTCGGATATAGCCGGCCAGAAATTCAAAGCGATCAGGATGTGGCACGACGTAGAGGAG
TTTCAGCGGGTTCGGAGACAGGATTGGGAAGCCGTGCTAAAAGGAATCGTCGGTTACTTCCAGTCCGAAACGTTC
CGCGAGGAGGTTCTCGAGTCCGAGTTCAACGTGGAGAGAGCCGGATTTGCTTTTGCGGCGTCACAGATCGTCGGC
TTGCTCAAGACGGCCCGGGAGAGTAAGCGGGCGAACGAAACGGACCAGATGCATACCGAGGCGGCGCTATTCAAC
GCTACGGTTCAAGTTTACGAGACCATGTGCCAGCCTCTGTTCAAGCGCAAGGTCTCGATGGTGAAAGAGAAGCAG
CAAGCCGCTAAGACGTTTGTGAGACAGGAACTCGTCAAGTTTAATAACGAGTTTGCCAATAGAAGCAAGGCGATG
TTTAAAGGGATTATTGCATCACCGACACCAAAGATGGGATCTAAAGATAGTGAAGAGAATCAAATCGACCGGGTC
ATTAGGGAGAGGCTCGGGAAACCGATCTCGATCGATATACAGCCTCGTCACCTCCCGGGAGAGAGTTGA
Gene >Ophio5|2012
ATGCACATTAGGCGAGCCACTATATTGGCCTTCCTGTGGCTCCAGTGGCCTAGCATTAGCAGTACTAGTGGCTGT
TTCGGCAGTCTTTGCCAGTCCACAAAGGTTACACCGCTAGGGGGGCCATCCGCCTATCGGGTCGATAGGAGAGAT
CCAAAGACAATCAAAGCAGCAGGAGGCTTTCGCGCCAAGGGGAAAGACTTTAGCATCTATAAGCATGCGGAACTC
GGTTCCAAGAACACAGCCTATGTCTCGACTTCGCAACAGGCTGCTAATGGCGCCGAAATCTTCGCGACGCCTCCT
CCACCGAAAGGCCTCCGCAGCTTCAAGGATTATAAGGGGCAGTACCTATACGACATACATCCCACTTCCAACTTT
GTCGATACCGAGTTGACGCTCGGGCCATGGTCGACACACCGCGAATATGAGCTGTTAGCGGCTGGTGGCATACCG
TTCGCCCAAATTAAGGGCTGGACACACCTCCCCAGAGGTAGTGATTCGCTAACATCGGAGAGGAAGTATGTGAGA
AATCCAGACTACGATCCAGCCAGGTGGGAAGGCCAGTCGTGGAACAAAGACCCGCAGTATCAACTAGCCGGCTTT
ACAGAGGGGATGGATCGGCTCAACGACCGCGCCCCCAAGTTCCATCCCCACACTCGAGAGCCTTACAAGCAGTTC
AAAGATCAGTCTGAGTCGGGACTTGAGACGGAAGGTTTGAAGTTTATCGAACAACACGGGAAAGTTCCTGGAATC
GCCAGCTTCGAGCCATGCTTCGGCCTCGGTGGACGAGTTAAACGTGATGCTAATGACTGTTGGCTAAGAAACAAA
GAAGTTGCCGATATCGAAGTTTTCACCCCAGATACTAACGGGGAAAAAGATGGACTGACCAGCGAGGCACTAAAA
GAAGAGTCAGCAGTCGTTGATTCCGCCGCAGAGGGAGAACTGGCATCCTTGACCGACAGATTGGCGGAAAGCGAG
TTTGCTACGGTCCTTCAGCGTCTCTTATTGACGGATTTTCTAAAGGGGAAGAAGATGTCAGTGTCCGAGCTCCGG
GCGAGATTCAGCGGCTACCAGCCGTTGAACAAGCTTGCGAAGCCCAGAGCCCTCTTGCGAAGGTTAAATGGACAT
GCTCTGACCGTTGCTGTCCTGGGCGTCTGGGTGAAGGATGTCATCGAAGTGTTCGTGAGTCAGATCACGACGGCC
TTTGACAAGTTTGTTACAGTGACGTCTATCATCCCCGTCGTCGGTTGCTTGACTTCGTCTATTGCGAGGAAGGAT
GGCGTCGATGGAGCCTTGTGCGTCGTCGGCGACGTCCTTCTGTTCTCTCCGTTATGGCCTTTCGGCATCGCAGTT
CATGCTTTCCGATTCCTTTCGGATATAGCCGGCCAGAAATTCAAAGCGATCAGGATGTGGCACGACGTAGAGGAG
TTTCAGCGGGTTCGGAGACAGGATTGGGAAGCCGTGCTAAAAGGAATCGTCGGTTACTTCCAGTCCGAAACGTTC
CGCGAGGAGGTTCTCGAGTCCGAGTTCAACGTGGAGAGAGCCGGATTTGCTTTTGCGGCGTCACAGATCGTCGGC
TTGCTCAAGACGGCCCGGGAGAGTAAGCGGGCGAACGAAACGGACCAGATGCATACCGAGGCGGCGCTATTCAAC
GCTACGGTTCAAGTTTACGAGACCATGTGCCAGCCTCTGTTCAAGCGCAAGGTCTCGATGGTGAAAGAGAAGCAG
CAAGCCGCTAAGACGTTTGTGAGACAGGAACTCGTCAAGTTTAATAACGAGTTTGCCAATAGAAGCAAGGCGATG
TTTAAAGGGATTATTGCATCACCGACACCAAAGTAAGTTATCGGTATCTACGACCTAACTCCTCTGTAAAGGTAG
AAGAGCTAAAAGAACCCAAGGATGGGATCTAAAGATAGTGAAGAGAATCAAATCGACCGGGTCATTAGGGAGAGG
CTCGGGAAACCGATCTCGATCGATATACAGGTAATATTCCGGGACATACAGCGACACTCGAACCACCTAAGGCAT
TGTTGGATGAGAGACGTTCGCTCTCTGGGAGAGAAAGGACAGCATGGCCGCAACGCAACAGACCTCATAGAAAGC
CGTAGGGATATAGATCCTATAAACAGTAGATAGCCTCGTCACCTCCCGGGAGAGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail