Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|201
Gene name
Locationscaffold_1032:667..3270
Strand+
Gene length (bp)2603
Transcript length (bp)2013
Coding sequence length (bp)2010
Protein length (aa) 670

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family 8.7E-43 257 449

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38830|NDT80_YEAST Meiosis-specific transcription factor NDT80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDT80 PE=1 SV=4 246 452 3.0E-09

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4452 0.9014 0.0191 0.0247 0.0283 0.001 0.0442 0.0468 0.0069 0.0096

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3107
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5819
Ophiocordyceps australis map64 (Brazil) OphauB2|1276
Ophiocordyceps camponoti-floridani Ophcf2|04064
Ophiocordyceps camponoti-rufipedis Ophun1|1089
Ophiocordyceps kimflemingae Ophio5|201 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5413

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|201
MPEKQSMGASVMYIQNIASSAVTSHRNRPADRRSNVETQDYTPSPTQCTDLGYLELQPQPGGDLRFSQETHAPPS
VSIDATQPSPLSSLFPSNSLHQGASYPPEDASALYQPPHGSIYGADVRPPRLSSNSTPSTGMAHAQAHAQRTPGP
HIGSQIGGLEPYSTVRRSSDHLSRSPSFPTGPLRRHHPSQSSLGGGFATPRMDPGQYPGRPAQLLVPPLQPVQML
GILSYIDSAMTPVKVDISGAVDKGPFLSYDHEWTCYRRNYLNCVCSFTMNPQYFPNLPVQFTPSSGPGSAPSQPF
HVYGFAMCISAVVADNEQQNIELVQHTPKRDKGPINKPSKIPMAPKTGPPSHHAMNPYGDGSRGLYTDGLGTGQP
GGQQLPAEHTFERIQFKHATLNNGKRRAAQQYYHLIVELWADVGAQRPDQYIKVAFRKSAKMIVRGRSPGHYQNE
RRGSQGSGPGGSAGSLGGYPGMSPIPEYGNGSSGAMLSGGAGTGGYATTAYDGRGGGAGTGSGAGAGSGSGVGVY
GNSRQQQQQQQQHQQHQQQHQHQHQHQHQHHQQELTDEAMLPPSADDGKSLDGPKGYQLYQSSAYDNHHDRVDLF
SSHREGGLPSMTTDSKVKNELDFNMLPRPFHPTAPRLGDQRSHEHYDGKATSGAYYPSLVSSTGIHMTMA
Coding >Ophio5|201
ATGCCGGAAAAGCAGTCCATGGGAGCCTCAGTCATGTACATACAAAACATAGCTTCGTCCGCTGTCACGAGCCAT
CGGAACCGGCCGGCGGACCGTCGTTCTAACGTCGAGACGCAGGACTACACTCCGTCGCCGACGCAGTGCACCGAC
CTGGGCTATCTCGAACTCCAGCCGCAGCCGGGAGGGGATTTGAGATTCAGCCAGGAGACGCATGCTCCGCCTTCG
GTCTCCATAGATGCTACCCAGCCGTCGCCGCTCTCGAGCCTCTTCCCCTCCAACAGCCTGCATCAGGGCGCATCC
TACCCTCCAGAGGACGCGAGCGCCCTGTACCAGCCGCCGCACGGATCCATCTATGGAGCAGACGTTCGGCCGCCT
CGCCTAAGCTCCAACTCGACGCCATCGACGGGCATGGCCCATGCCCAAGCCCACGCTCAACGCACGCCAGGACCG
CACATCGGGTCGCAGATAGGCGGCCTGGAGCCGTACTCGACCGTCCGCCGCAGCTCCGATCACCTCTCGCGCTCG
CCGTCCTTCCCGACGGGCCCCCTGCGACGCCATCATCCTTCCCAGTCCTCGCTCGGCGGAGGCTTCGCGACCCCG
AGGATGGACCCGGGCCAGTATCCGGGACGGCCGGCCCAGCTGCTGGTGCCTCCTCTGCAGCCGGTCCAGATGCTG
GGCATTCTCAGTTACATCGACTCGGCCATGACGCCCGTCAAGGTGGACATCTCGGGAGCCGTCGACAAGGGGCCC
TTCCTGTCGTACGACCACGAATGGACGTGCTACCGACGCAACTACCTCAACTGCGTCTGCTCCTTTACCATGAAC
CCGCAGTACTTCCCCAACCTGCCGGTCCAGTTCACGCCCTCTTCCGGCCCCGGCTCGGCCCCGAGCCAGCCCTTT
CACGTTTACGGCTTCGCCATGTGCATCTCGGCCGTCGTGGCCGATAATGAGCAGCAGAACATTGAGCTGGTCCAG
CACACGCCCAAGCGCGACAAGGGGCCCATCAACAAGCCGTCCAAGATTCCCATGGCGCCCAAGACGGGCCCGCCC
TCGCACCACGCCATGAACCCCTATGGCGATGGCTCTCGCGGCCTGTATACCGACGGGCTCGGCACCGGCCAGCCT
GGCGGACAGCAGCTGCCGGCCGAACACACCTTTGAGCGCATCCAGTTCAAGCACGCCACGCTCAACAACGGAAAG
CGGCGAGCTGCGCAGCAATACTACCATCTGATTGTCGAGTTGTGGGCCGACGTCGGCGCCCAGAGGCCCGATCAG
TACATCAAGGTGGCTTTCCGTAAGTCGGCCAAGATGATTGTCCGTGGCCGCTCGCCGGGCCATTACCAGAATGAG
AGACGCGGCAGCCAGGGCAGCGGGCCGGGCGGTTCGGCCGGCAGTCTGGGCGGCTACCCGGGCATGAGTCCCATT
CCCGAGTACGGCAACGGCTCGTCCGGCGCCATGCTCAGCGGAGGCGCCGGCACGGGAGGTTATGCCACTACGGCC
TACGATGGCCGCGGGGGAGGAGCCGGGACCGGATCCGGGGCCGGGGCCGGATCAGGATCCGGTGTCGGAGTCTAC
GGCAATTCGCGACAGCAGCAGCAGCAGCAGCAGCAGCATCAGCAGCATCAACAACAACATCAACACCAACACCAA
CACCAACACCAACACCACCAACAGGAGCTGACGGACGAGGCCATGCTGCCGCCCTCAGCCGATGACGGGAAATCT
CTCGACGGTCCCAAGGGCTACCAGCTATATCAGAGCTCGGCCTACGACAACCATCACGATCGCGTCGACCTCTTC
AGCAGCCATCGCGAGGGCGGCCTGCCGAGCATGACGACCGATTCCAAGGTCAAGAACGAGCTCGACTTCAACATG
CTGCCGCGTCCTTTCCATCCGACGGCACCGCGCCTCGGAGACCAGCGATCGCACGAGCATTACGACGGAAAGGCG
ACATCCGGCGCCTACTATCCTTCCCTGGTCTCTTCGACTGGAATCCACATGACCATGGCA
Transcript >Ophio5|201
ATGCCGGAAAAGCAGTCCATGGGAGCCTCAGTCATGTACATACAAAACATAGCTTCGTCCGCTGTCACGAGCCAT
CGGAACCGGCCGGCGGACCGTCGTTCTAACGTCGAGACGCAGGACTACACTCCGTCGCCGACGCAGTGCACCGAC
CTGGGCTATCTCGAACTCCAGCCGCAGCCGGGAGGGGATTTGAGATTCAGCCAGGAGACGCATGCTCCGCCTTCG
GTCTCCATAGATGCTACCCAGCCGTCGCCGCTCTCGAGCCTCTTCCCCTCCAACAGCCTGCATCAGGGCGCATCC
TACCCTCCAGAGGACGCGAGCGCCCTGTACCAGCCGCCGCACGGATCCATCTATGGAGCAGACGTTCGGCCGCCT
CGCCTAAGCTCCAACTCGACGCCATCGACGGGCATGGCCCATGCCCAAGCCCACGCTCAACGCACGCCAGGACCG
CACATCGGGTCGCAGATAGGCGGCCTGGAGCCGTACTCGACCGTCCGCCGCAGCTCCGATCACCTCTCGCGCTCG
CCGTCCTTCCCGACGGGCCCCCTGCGACGCCATCATCCTTCCCAGTCCTCGCTCGGCGGAGGCTTCGCGACCCCG
AGGATGGACCCGGGCCAGTATCCGGGACGGCCGGCCCAGCTGCTGGTGCCTCCTCTGCAGCCGGTCCAGATGCTG
GGCATTCTCAGTTACATCGACTCGGCCATGACGCCCGTCAAGGTGGACATCTCGGGAGCCGTCGACAAGGGGCCC
TTCCTGTCGTACGACCACGAATGGACGTGCTACCGACGCAACTACCTCAACTGCGTCTGCTCCTTTACCATGAAC
CCGCAGTACTTCCCCAACCTGCCGGTCCAGTTCACGCCCTCTTCCGGCCCCGGCTCGGCCCCGAGCCAGCCCTTT
CACGTTTACGGCTTCGCCATGTGCATCTCGGCCGTCGTGGCCGATAATGAGCAGCAGAACATTGAGCTGGTCCAG
CACACGCCCAAGCGCGACAAGGGGCCCATCAACAAGCCGTCCAAGATTCCCATGGCGCCCAAGACGGGCCCGCCC
TCGCACCACGCCATGAACCCCTATGGCGATGGCTCTCGCGGCCTGTATACCGACGGGCTCGGCACCGGCCAGCCT
GGCGGACAGCAGCTGCCGGCCGAACACACCTTTGAGCGCATCCAGTTCAAGCACGCCACGCTCAACAACGGAAAG
CGGCGAGCTGCGCAGCAATACTACCATCTGATTGTCGAGTTGTGGGCCGACGTCGGCGCCCAGAGGCCCGATCAG
TACATCAAGGTGGCTTTCCGTAAGTCGGCCAAGATGATTGTCCGTGGCCGCTCGCCGGGCCATTACCAGAATGAG
AGACGCGGCAGCCAGGGCAGCGGGCCGGGCGGTTCGGCCGGCAGTCTGGGCGGCTACCCGGGCATGAGTCCCATT
CCCGAGTACGGCAACGGCTCGTCCGGCGCCATGCTCAGCGGAGGCGCCGGCACGGGAGGTTATGCCACTACGGCC
TACGATGGCCGCGGGGGAGGAGCCGGGACCGGATCCGGGGCCGGGGCCGGATCAGGATCCGGTGTCGGAGTCTAC
GGCAATTCGCGACAGCAGCAGCAGCAGCAGCAGCAGCATCAGCAGCATCAACAACAACATCAACACCAACACCAA
CACCAACACCAACACCACCAACAGGAGCTGACGGACGAGGCCATGCTGCCGCCCTCAGCCGATGACGGGAAATCT
CTCGACGGTCCCAAGGGCTACCAGCTATATCAGAGCTCGGCCTACGACAACCATCACGATCGCGTCGACCTCTTC
AGCAGCCATCGCGAGGGCGGCCTGCCGAGCATGACGACCGATTCCAAGGTCAAGAACGAGCTCGACTTCAACATG
CTGCCGCGTCCTTTCCATCCGACGGCACCGCGCCTCGGAGACCAGCGATCGCACGAGCATTACGACGGAAAGGCG
ACATCCGGCGCCTACTATCCTTCCCTGGTCTCTTCGACTGGAATCCACATGACCATGGCATGA
Gene >Ophio5|201
ATGCCGGAAAAGCAGTCCATGGGAGCCTCAGTCATGTACATACAAAACATAGCTTCGTCCGCTGTCACGAGCCAT
CGGAACCGGCCGGCGGACCGTCGTTCTAACGTCGAGACGCAGGACTACACTCCGTCGCCGACGCAGTGCACCGAC
CTGGGCTATCTCGAACTCCAGCCGCAGCCGGGAGGGGATTTGAGGTGAGTGTTTTTTTCTGTCTCTTTTTCTCTG
TCTCTCTCTCTCTCTTTCTCTCTTACTCTTACTCTTACTCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCTCTCCTCCCACGACCCCT
ACCGGCTGTGGGTCTGCCACCTTACGAGTGTGTGTCGACTTCCGATCCTGCCCCGCCGTAGCTGTTGATGGAGCC
GGTTCGATCAAGATCAGCCAAGCAAACAGATCCCATCTATCTTGTCATTCTGCTTCGCGGCATTGCTTGCGGCCA
CCCCCCTCCTTTACCTCATCGACTGTCCCTTTGGCCCCCCCCCCCCCTCTTCTTCCCTTTCATCTTCAACTCAAC
CCTCTTGTCCCCGTCCCTCTCTCTTCTCCGTACTACTACACCCGTCAGCTTGCGGGGGGTGGAGGTATAACCTAC
TGGCGCACAGCTCTCTGTCTCTCTCTGTCTCTCTCTCTCTCTCCCTTTCCGTCTGTACATGTCGCGCATCATCAC
TGTCGATTATGCTCTGACCGAGTGGCCATTGCAGATTCAGCCAGGAGACGCATGCTCCGCCTTCGGTCTCCATAG
ATGCTACCCAGCCGTCGCCGCTCTCGAGCCTCTTCCCCTCCAACAGCCTGCATCAGGGCGCATCCTACCCTCCAG
AGGACGCGAGCGCCCTGTACCAGCCGCCGCACGGATCCATCTATGGAGCAGACGTTCGGCCGCCTCGCCTAAGCT
CCAACTCGACGCCATCGACGGGCATGGCCCATGCCCAAGCCCACGCTCAACGCACGCCAGGACCGCACATCGGGT
CGCAGATAGGCGGCCTGGAGCCGTACTCGACCGTCCGCCGCAGCTCCGATCACCTCTCGCGCTCGCCGTCCTTCC
CGACGGGCCCCCTGCGACGCCATCATCCTTCCCAGTCCTCGCTCGGCGGAGGCTTCGCGACCCCGAGGATGGACC
CGGGCCAGTATCCGGGACGGCCGGCCCAGCTGCTGGTGCCTCCTCTGCAGCCGGTCCAGATGCTGGGCATTCTCA
GTTACATCGACTCGGCCATGACGCCCGTCAAGGTGGACATCTCGGGAGCCGTCGACAAGGGGCCCTTCCTGTCGT
ACGACCACGAATGGACGTGCTACCGACGCAACTACCTCAACTGCGTCTGCTCCTTTACCATGAACCCGCAGTACT
TCCCCAACCTGCCGGTCCAGTTCACGCCCTCTTCCGGCCCCGGCTCGGCCCCGAGCCAGCCCTTTCACGTTTACG
GCTTCGCCATGTGCATCTCGGCCGTCGTGGCCGATAATGAGCAGCAGAACATTGAGCTGGTCCAGCACACGCCCA
AGCGCGACAAGGGGCCCATCAACAAGCCGTCCAAGATTCCCATGGCGCCCAAGACGGGCCCGCCCTCGCACCACG
CCATGAACCCCTATGGCGATGGCTCTCGCGGCCTGTATACCGACGGGCTCGGCACCGGCCAGCCTGGCGGACAGC
AGCTGCCGGCCGAACACACCTTTGAGCGCATCCAGTTCAAGCACGCCACGCTCAACAACGGAAAGCGGCGAGCTG
CGCAGCAATACTACCATCTGATTGTCGAGTTGTGGGCCGACGTCGGCGCCCAGAGGCCCGATCAGTACATCAAGG
TGGCTTTCCGTAAGTCGGCCAAGATGATTGTCCGTGGCCGCTCGCCGGGCCATTACCAGAATGAGAGACGCGGCA
GCCAGGGCAGCGGGCCGGGCGGTTCGGCCGGCAGTCTGGGCGGCTACCCGGGCATGAGTCCCATTCCCGAGTACG
GCAACGGCTCGTCCGGCGCCATGCTCAGCGGAGGCGCCGGCACGGGAGGTTATGCCACTACGGCCTACGATGGCC
GCGGGGGAGGAGCCGGGACCGGATCCGGGGCCGGGGCCGGATCAGGATCCGGTGTCGGAGTCTACGGCAATTCGC
GACAGCAGCAGCAGCAGCAGCAGCAGCATCAGCAGCATCAACAACAACATCAACACCAACACCAACACCAACACC
AACACCACCAACAGGAGCTGACGGACGAGGCCATGCTGCCGCCCTCAGCCGATGACGGGAAATCTCTCGACGGTC
CCAAGGGCTACCAGCTATATCAGAGCTCGGCCTACGACAACCATCACGATCGCGTCGACCTCTTCAGCAGCCATC
GCGAGGGCGGCCTGCCGAGCATGACGACCGATTCCAAGGTCAAGAACGAGCTCGACTTCAACATGCTGCCGCGTC
CTTTCCATCCGACGGCACCGCGCCTCGGAGACCAGCGATCGCACGAGCATTACGACGGAAAGGCGACATCCGGCG
CCTACTATCCTTCCCTGGTCTCTTCGACTGGAATCCACATGACCATGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail