Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2006
Gene name
Locationscaffold_18:31704..33414
Strand-
Gene length (bp)1710
Transcript length (bp)1650
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 433 544 2.0E-10
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 433 544 3.0E-10
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 445 531 1.0E-09
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 444 535 1.0E-09
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 433 544 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 433 544 2.0E-10
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 433 544 3.0E-10
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 445 531 1.0E-09
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 444 535 1.0E-09
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 433 544 2.0E-09
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 445 531 4.0E-09
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 444 531 7.0E-09
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 429 544 1.0E-08
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 429 544 2.0E-08
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 444 539 2.0E-08
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 445 531 3.0E-08
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 445 534 3.0E-08
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 444 539 3.0E-08
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 444 539 3.0E-08
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 445 531 3.0E-08
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 444 531 4.0E-08
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 444 531 4.0E-08
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 444 539 4.0E-08
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 444 539 4.0E-08
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 444 539 4.0E-08
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 444 535 5.0E-08
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 444 539 6.0E-08
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 444 531 1.0E-07
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 444 539 1.0E-07
sp|Q58NQ5|PLAG1_CHICK Zinc finger protein PLAG1 OS=Gallus gallus GN=PLAG1 PE=2 SV=1 444 540 2.0E-07
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 444 539 2.0E-07
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 444 539 2.0E-07
sp|Q2I689|PLAL1_PIG Zinc finger protein PLAGL1 OS=Sus scrofa GN=PLAGL1 PE=2 SV=1 444 540 2.0E-07
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 445 534 2.0E-07
sp|Q59KL6|TF3A_CANAL Transcription factor IIIA OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PZF1 PE=2 SV=1 445 533 2.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 431 530 3.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 444 531 3.0E-07
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 444 539 3.0E-07
sp|Q9UM63|PLAL1_HUMAN Zinc finger protein PLAGL1 OS=Homo sapiens GN=PLAGL1 PE=1 SV=2 444 540 3.0E-07
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 444 539 4.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 431 530 4.0E-07
sp|Q9P8W3|ACE1_HYPJE Zinc finger transcription factor ace1 OS=Hypocrea jecorina GN=ace1 PE=3 SV=1 444 535 4.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 431 530 5.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 431 530 5.0E-07
sp|Q6DJT9|PLAG1_HUMAN Zinc finger protein PLAG1 OS=Homo sapiens GN=PLAG1 PE=1 SV=1 444 540 5.0E-07
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 444 539 6.0E-07
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 444 531 6.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 444 531 7.0E-07
sp|Q9QYE0|PLAG1_MOUSE Zinc finger protein PLAG1 OS=Mus musculus GN=Plag1 PE=2 SV=2 444 540 7.0E-07
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 444 531 7.0E-07
sp|Q5U2T6|PLAG1_RAT Zinc finger protein PLAG1 OS=Rattus norvegicus GN=Plag1 PE=2 SV=1 444 540 8.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 444 531 1.0E-06
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 445 533 1.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 431 530 1.0E-06
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 445 533 1.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 444 531 1.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 444 531 1.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 431 530 1.0E-06
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 444 535 2.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 434 530 2.0E-06
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 447 534 2.0E-06
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 447 534 2.0E-06
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 447 534 3.0E-06
sp|Q9UPG8|PLAL2_HUMAN Zinc finger protein PLAGL2 OS=Homo sapiens GN=PLAGL2 PE=2 SV=1 441 540 3.0E-06
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 444 543 3.0E-06
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 444 537 3.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 444 531 3.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 439 530 5.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 439 530 6.0E-06
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis GN=zic5 PE=2 SV=1 444 531 6.0E-06
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 444 531 7.0E-06
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 445 501 7.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 445 531 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2006
MAVAVVLRRELGDGAVAGTVVGVIIFLLVICLYPIIVGQIRRRRRRRLDAETGGPQALDLGHGPRLSSTDSCKNE
VELSRATQKWDSSSALRDHDGFVASPVPSYGHQSVSVSDGRYHRPGPVQGMSADYYNAPISSEAASSHIDVDTSH
ARPSAFLGNTVKDRVRRFLRQGSERSADSCYAPSGRQLALSSGPAKPPHTATWKAMGTLQSSTPPMDIPQPYAEQ
TSKSASPSPPAYPAPGTVNPMDIMPASTESEVWHRTEQELLGFSHGRAAFGSSPVQHGDGFGSHDVEMVSPLDHT
ANDQHLDEPGNGDPGPVSPLEPGGGFDNVHTGIVSPPSPAAPSEPPAVVLVQAEASVCAQHAEQNRPQTGDTAWA
HLQSRTYMSNPSTPDRGPASVDPSPPNIPLPQDSLGEDSLTSSDYRSSNSPKSPSTASRAAYRSDEFDPYRCNEP
GCDQAFDHLHKLKHHQRYHSKSHKCTFAGCDRAFGTKTHLDRHINERHDKKRKFYCPIPDCLYHKTGGKGFSRRD
NWRRHMVAKHATSAGYAPIIVDTE
Coding >Ophio5|2006
ATGGCGGTCGCGGTTGTGCTGCGGCGCGAGCTGGGCGACGGCGCCGTGGCGGGGACTGTCGTCGGCGTCATCATC
TTCCTGCTCGTCATATGCCTCTATCCTATCATTGTCGGTCAAATCAGACGACGACGACGGCGACGGCTCGATGCC
GAGACAGGCGGTCCGCAAGCTTTGGATTTGGGGCACGGCCCGCGGCTTTCGTCTACCGACTCGTGTAAAAATGAG
GTCGAGCTGTCCCGTGCAACCCAGAAATGGGACTCGTCTTCAGCATTACGTGACCATGATGGCTTCGTCGCGTCG
CCGGTGCCGTCGTATGGCCATCAGTCGGTGTCTGTGTCTGACGGACGATATCATCGGCCTGGTCCTGTGCAGGGA
ATGAGCGCCGACTATTACAACGCCCCGATATCGTCAGAGGCAGCTTCTTCTCATATCGACGTCGATACTTCTCAC
GCGCGCCCGTCTGCCTTTCTGGGAAACACCGTCAAAGATCGAGTCAGACGGTTTCTGAGGCAAGGAAGTGAACGC
TCAGCAGACTCTTGCTATGCGCCCAGCGGCCGACAGCTTGCCTTGAGCAGCGGTCCGGCCAAGCCCCCGCATACG
GCAACATGGAAGGCGATGGGCACATTGCAGTCTTCTACACCGCCCATGGATATACCACAGCCGTATGCCGAACAG
ACTTCGAAGAGCGCCTCGCCCTCGCCCCCCGCGTATCCGGCGCCAGGGACCGTCAACCCGATGGATATCATGCCA
GCCAGCACAGAGTCTGAAGTCTGGCATCGGACCGAGCAGGAGTTGCTGGGGTTCTCCCATGGCCGGGCCGCCTTC
GGCTCATCCCCCGTACAGCACGGCGATGGCTTTGGCAGCCATGATGTGGAGATGGTTTCTCCGCTAGACCATACC
GCCAATGACCAGCACCTCGATGAGCCCGGCAACGGAGATCCGGGTCCCGTCTCCCCATTGGAGCCCGGTGGCGGC
TTCGACAACGTCCACACGGGCATCGTCTCCCCGCCGTCTCCCGCAGCACCCTCAGAGCCTCCCGCTGTCGTCCTC
GTCCAAGCCGAGGCGTCCGTCTGCGCGCAACATGCCGAGCAGAACCGGCCGCAAACTGGCGACACGGCCTGGGCG
CACCTCCAGTCACGCACCTACATGTCTAACCCGTCCACGCCTGATCGCGGGCCCGCATCAGTCGACCCGTCGCCG
CCCAATATCCCTCTGCCTCAAGACAGTCTCGGGGAGGATTCTCTCACTAGCTCCGACTATCGATCTAGCAACTCG
CCCAAGTCGCCAAGCACGGCATCCCGCGCCGCCTACCGAAGCGACGAGTTCGACCCTTACCGCTGCAATGAACCG
GGCTGCGATCAGGCCTTCGATCACCTACATAAACTCAAGCATCATCAACGTTATCATAGCAAATCTCACAAATGC
ACCTTCGCCGGCTGCGACAGGGCCTTTGGCACAAAGACACACCTCGACCGCCACATCAACGAGAGGCACGACAAA
AAGAGGAAGTTTTACTGCCCCATTCCGGACTGCTTATATCACAAGACCGGCGGTAAAGGCTTCTCCAGAAGGGAT
AACTGGAGGAGGCACATGGTGGCAAAGCACGCCACAAGCGCGGGGTACGCCCCTATCATCGTCGATACTGAG
Transcript >Ophio5|2006
ATGGCGGTCGCGGTTGTGCTGCGGCGCGAGCTGGGCGACGGCGCCGTGGCGGGGACTGTCGTCGGCGTCATCATC
TTCCTGCTCGTCATATGCCTCTATCCTATCATTGTCGGTCAAATCAGACGACGACGACGGCGACGGCTCGATGCC
GAGACAGGCGGTCCGCAAGCTTTGGATTTGGGGCACGGCCCGCGGCTTTCGTCTACCGACTCGTGTAAAAATGAG
GTCGAGCTGTCCCGTGCAACCCAGAAATGGGACTCGTCTTCAGCATTACGTGACCATGATGGCTTCGTCGCGTCG
CCGGTGCCGTCGTATGGCCATCAGTCGGTGTCTGTGTCTGACGGACGATATCATCGGCCTGGTCCTGTGCAGGGA
ATGAGCGCCGACTATTACAACGCCCCGATATCGTCAGAGGCAGCTTCTTCTCATATCGACGTCGATACTTCTCAC
GCGCGCCCGTCTGCCTTTCTGGGAAACACCGTCAAAGATCGAGTCAGACGGTTTCTGAGGCAAGGAAGTGAACGC
TCAGCAGACTCTTGCTATGCGCCCAGCGGCCGACAGCTTGCCTTGAGCAGCGGTCCGGCCAAGCCCCCGCATACG
GCAACATGGAAGGCGATGGGCACATTGCAGTCTTCTACACCGCCCATGGATATACCACAGCCGTATGCCGAACAG
ACTTCGAAGAGCGCCTCGCCCTCGCCCCCCGCGTATCCGGCGCCAGGGACCGTCAACCCGATGGATATCATGCCA
GCCAGCACAGAGTCTGAAGTCTGGCATCGGACCGAGCAGGAGTTGCTGGGGTTCTCCCATGGCCGGGCCGCCTTC
GGCTCATCCCCCGTACAGCACGGCGATGGCTTTGGCAGCCATGATGTGGAGATGGTTTCTCCGCTAGACCATACC
GCCAATGACCAGCACCTCGATGAGCCCGGCAACGGAGATCCGGGTCCCGTCTCCCCATTGGAGCCCGGTGGCGGC
TTCGACAACGTCCACACGGGCATCGTCTCCCCGCCGTCTCCCGCAGCACCCTCAGAGCCTCCCGCTGTCGTCCTC
GTCCAAGCCGAGGCGTCCGTCTGCGCGCAACATGCCGAGCAGAACCGGCCGCAAACTGGCGACACGGCCTGGGCG
CACCTCCAGTCACGCACCTACATGTCTAACCCGTCCACGCCTGATCGCGGGCCCGCATCAGTCGACCCGTCGCCG
CCCAATATCCCTCTGCCTCAAGACAGTCTCGGGGAGGATTCTCTCACTAGCTCCGACTATCGATCTAGCAACTCG
CCCAAGTCGCCAAGCACGGCATCCCGCGCCGCCTACCGAAGCGACGAGTTCGACCCTTACCGCTGCAATGAACCG
GGCTGCGATCAGGCCTTCGATCACCTACATAAACTCAAGCATCATCAACGTTATCATAGCAAATCTCACAAATGC
ACCTTCGCCGGCTGCGACAGGGCCTTTGGCACAAAGACACACCTCGACCGCCACATCAACGAGAGGCACGACAAA
AAGAGGAAGTTTTACTGCCCCATTCCGGACTGCTTATATCACAAGACCGGCGGTAAAGGCTTCTCCAGAAGGGAT
AACTGGAGGAGGCACATGGTGGCAAAGCACGCCACAAGCGCGGGGTACGCCCCTATCATCGTCGATACTGAGTGA
Gene >Ophio5|2006
ATGGCGGTCGCGGTTGTGCTGCGGCGCGAGCTGGGCGACGGCGCCGTGGCGGGGACTGTCGTCGGCGTCATCATC
TTCCTGCTCGTCATATGCCTCTATCCTATCATTGTCGGTCAAATCAGACGACGACGACGGCGACGGCTCGATGCC
GAGACAGGCGGTCCGCAAGCTTTGGATTTGGGGCACGGCCCGCGGCTTTCGTCTACCGACTCGTGTAAAAATGAG
GTCGAGCTGTCCCGTGCAACCCAGAAATGGGACTCGTCTTCAGCATTACGTGACCATGATGGCTTCGTCGCGTCG
CCGGTGCCGTCGTATGGCCATCAGTCGGTGTCTGTGTCTGACGGACGATATCATCGGCCTGGTCCTGTGCAGGGA
ATGAGCGCCGACTATTACAACGCCCCGATATCGTCAGAGGCAGCTTCTTCTCATATCGACGTCGATACTTCTCAC
GCGCGCCCGTCTGCCTTTCTGGGAAACACCGTCAAAGATCGAGTCAGACGGTTTCTGAGGCAAGGAAGTGAACGC
TCAGCAGACTCTTGCTATGCGCCCAGCGGCCGACAGCTTGCCTTGAGCAGCGGTCCGGCCAAGCCCCCGCATACG
GCAACATGGAAGGCGATGGGCACATTGCAGTCTTCTACACCGCCCATGGATATACCACAGCCGTATGCCGAACAG
ACTTCGAAGAGCGCCTCGCCCTCGCCCCCCGCGTATCCGGCGCCAGGGACCGTCAACCCGATGGATATCATGCCA
GCCAGCACAGAGTCTGAAGTCTGGCATCGGACCGAGCAGGAGTTGCTGGGGTTCTCCCATGGCCGGGCCGCCTTC
GGCTCATCCCCCGTACAGCACGGCGATGGCTTTGGCAGCCATGATGTGGAGATGGTTTCTCCGCTAGACCATACC
GCCAATGACCAGCACCTCGATGAGCCCGGCAACGGAGATCCGGGTCCCGTCTCCCCATTGGAGCCCGGTGGCGGC
TTCGACAACGTCCACACGGGCATCGTCTCCCCGCCGTCTCCCGCAGCACCCTCAGAGCCTCCCGCTGTCGTCCTC
GTCCAAGCCGAGGCGTCCGTCTGCGCGCAACATGCCGAGCAGAACCGGCCGCAAACTGGCGACACGGCCTGGGCG
CACCTCCAGTCACGCACCTACATGTCTAACCCGTCCACGCCTGATCGCGGGCCCGCATCAGTCGACCCGTCGCCG
CCCAATATCCCTCTGCCTCAAGACAGTCTCGGGGAGGATTCTCTCACTAGCTCCGACTATCGATCTAGCAACTCG
CCCAAGTCGCCAAGCACGGCATCCCGCGCCGCCTACCGAAGCGACGAGTTCGACCCTTACCGCTGCAATGAACCG
GGCTGCGATCAGGCCTTCGATCACCTACATAAACTCAAGTAAGTGACTTCCGAATCCTTTCTTTACTGAGTCGAG
ACTCAAGCAATTCGCCCGTGCAGGCATCATCAACGTTATCATAGCAAATCTCACAAATGCACCTTCGCCGGCTGC
GACAGGGCCTTTGGCACAAAGACACACCTCGACCGCCACATCAACGAGAGGCACGACAAAAAGAGGAAGTTTTAC
TGCCCCATTCCGGACTGCTTATATCACAAGACCGGCGGTAAAGGCTTCTCCAGAAGGGATAACTGGAGGAGGCAC
ATGGTGGCAAAGCACGCCACAAGCGCGGGGTACGCCCCTATCATCGTCGATACTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail