Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1993
Gene name
Locationscaffold_18:2905..4939
Strand+
Gene length (bp)2034
Transcript length (bp)2034
Coding sequence length (bp)2031
Protein length (aa) 677

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3342 0.9119 0.5214 0.1092 0.0814 0.0088 0.0479 0.0224 0.0197 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup117
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1568
Ophiocordyceps australis 1348a (Ghana) OphauG2|5034
Ophiocordyceps australis map64 (Brazil) OphauB2|4034
Ophiocordyceps camponoti-floridani Ophcf2|00717
Ophiocordyceps camponoti-floridani Ophcf2|06855
Ophiocordyceps camponoti-rufipedis Ophun1|2681
Ophiocordyceps camponoti-rufipedis Ophun1|3369
Ophiocordyceps kimflemingae Ophio5|1993 (this protein)
Ophiocordyceps kimflemingae Ophio5|2077
Ophiocordyceps kimflemingae Ophio5|6199
Ophiocordyceps kimflemingae Ophio5|7935
Ophiocordyceps subramaniannii Hirsu2|3551
Ophiocordyceps subramaniannii Hirsu2|3569
Ophiocordyceps subramaniannii Hirsu2|7031

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1993
MEQRISLLNTLSESLPVGAQYFESRNLLAGLGKRLSKRKIADERTLEYFMHLSIEDPVRAIVEQVSQIDKVRELF
DMGNGIVFENHPHAISDIGEEVLARVPPSTPPSRQDLTQLRPDQICIYRSGNDSCPEKRTMLYVSEYKAPHKLTA
PHLRDGLQQMNDIHKEVVNRTTIPAADVDPAGNFKYHAERLTASALAQTYHYMIEGGLEYGLMTTGEAIVFLKVD
WKEPETLYFHLSEPGPEVEKYEERVQFSSAVGQYLAFTLMALGKPGEHVEHPQDERDQVKARLKRWAVDFELALR
SIPETERRPPDSASSWAPTTHDDFELSPINLKGGRFRPGRGCDDRNKYARRRDESESSDDESGGGPPDPSSPSEQ
RRRRADANRARKREENQAQQPRQGTGDEGQRRYCTQACLLGLVRGGAMDPRCPNAECHDGPRGRTRAPHPISHST
WLQLLREQMRRTLDGGITKLGKSGARGVLFKVTLLSHGYTFVCKGTVEAFIPDLEHEAAVYKRLERVQGVHVPVF
LGAVDLRPLKRTYYYDFRVYIVHMTLLSWAGDEMGDVKATRMLEAKAAASLQAMHNQGVVHRDVRRFNMLFNEET
QSVMMIDFERAVLLKPLRRCLVQTSPNKRKSEPANTTTSAKGSSGKASGWREVMKAALAEDKRMLRGTFLELERC
CR
Coding >Ophio5|1993
ATGGAACAGCGGATAAGCCTTCTCAATACTCTCTCCGAAAGCCTGCCTGTCGGCGCTCAGTACTTTGAGAGCCGG
AACCTCCTAGCCGGCTTAGGAAAGAGATTGTCGAAGCGAAAGATAGCAGATGAAAGGACACTTGAATACTTTATG
CATCTCAGCATCGAGGATCCGGTTAGAGCCATCGTCGAACAAGTTTCACAGATTGACAAGGTGCGCGAGCTATTC
GACATGGGAAATGGCATCGTCTTCGAGAACCACCCTCACGCCATCAGCGACATTGGCGAGGAAGTGCTTGCTCGG
GTGCCGCCATCAACACCGCCCTCCCGACAAGATTTGACGCAGCTACGACCGGATCAAATCTGCATCTATCGATCG
GGTAATGACTCATGCCCGGAGAAGCGGACGATGCTCTACGTGTCTGAGTACAAGGCACCCCACAAGCTCACAGCT
CCGCACCTCCGCGACGGACTGCAGCAAATGAACGATATCCACAAGGAAGTCGTCAATCGGACCACGATCCCAGCA
GCTGACGTCGACCCGGCCGGCAATTTCAAGTATCACGCCGAAAGACTGACGGCATCTGCCCTCGCACAGACCTAT
CACTACATGATCGAGGGCGGCCTCGAGTACGGGCTGATGACGACTGGCGAGGCCATTGTCTTTCTCAAGGTGGAC
TGGAAAGAGCCTGAGACTCTATATTTCCACTTGTCTGAGCCTGGGCCGGAGGTGGAGAAGTATGAAGAGCGTGTG
CAGTTCAGCTCTGCCGTCGGACAGTATCTCGCCTTTACCCTTATGGCGCTCGGTAAGCCGGGCGAACATGTGGAA
CACCCTCAGGATGAGCGTGATCAAGTCAAGGCTAGGCTCAAAAGGTGGGCTGTCGATTTCGAACTTGCATTGCGA
TCGATTCCGGAAACCGAACGAAGGCCGCCGGACAGCGCGTCTAGCTGGGCACCTACGACACACGACGACTTTGAA
CTGTCGCCGATAAATCTGAAGGGGGGGAGATTCCGTCCAGGTAGAGGATGTGACGACAGGAACAAATATGCCCGA
AGACGAGACGAGTCAGAATCATCGGATGACGAGTCTGGAGGCGGGCCCCCGGATCCGTCGAGTCCCTCTGAGCAG
CGGCGACGACGAGCCGATGCAAACCGGGCTCGAAAGCGTGAAGAAAATCAGGCGCAGCAACCACGCCAAGGGACC
GGTGATGAAGGGCAACGCCGGTACTGCACACAAGCATGCCTCCTTGGACTGGTTCGGGGAGGCGCCATGGATCCT
CGTTGCCCCAACGCCGAGTGTCACGACGGGCCCCGAGGACGCACTCGTGCGCCACATCCCATCAGTCATTCTACA
TGGCTGCAACTTCTGCGTGAGCAGATGCGACGGACGCTGGATGGCGGCATCACGAAGCTAGGAAAGTCCGGTGCT
CGGGGAGTGCTTTTCAAGGTGACGCTGCTGTCGCACGGCTACACCTTCGTGTGCAAGGGCACAGTCGAGGCCTTC
ATCCCAGACCTTGAGCACGAAGCGGCCGTCTACAAGCGTCTCGAGCGGGTTCAGGGCGTCCACGTGCCGGTCTTT
CTGGGTGCCGTAGACCTCCGGCCGCTGAAGAGGACCTACTACTACGACTTCCGGGTTTACATTGTCCACATGACG
TTGCTTTCCTGGGCAGGAGACGAGATGGGCGACGTCAAGGCGACGAGAATGCTCGAGGCCAAGGCGGCCGCATCC
CTACAGGCTATGCACAACCAAGGTGTAGTGCACAGAGACGTGCGAAGGTTCAACATGCTGTTCAACGAGGAAACG
CAGAGCGTGATGATGATCGACTTCGAGCGCGCCGTCTTGCTGAAGCCACTGCGACGGTGCCTCGTCCAGACGTCG
CCCAACAAGAGAAAATCGGAGCCGGCCAACACGACGACTTCAGCCAAAGGCAGCAGCGGCAAAGCGAGCGGTTGG
CGAGAGGTCATGAAAGCTGCATTGGCCGAGGATAAGCGGATGCTGAGGGGGACGTTCCTGGAGCTGGAGAGGTGC
TGCCGA
Transcript >Ophio5|1993
ATGGAACAGCGGATAAGCCTTCTCAATACTCTCTCCGAAAGCCTGCCTGTCGGCGCTCAGTACTTTGAGAGCCGG
AACCTCCTAGCCGGCTTAGGAAAGAGATTGTCGAAGCGAAAGATAGCAGATGAAAGGACACTTGAATACTTTATG
CATCTCAGCATCGAGGATCCGGTTAGAGCCATCGTCGAACAAGTTTCACAGATTGACAAGGTGCGCGAGCTATTC
GACATGGGAAATGGCATCGTCTTCGAGAACCACCCTCACGCCATCAGCGACATTGGCGAGGAAGTGCTTGCTCGG
GTGCCGCCATCAACACCGCCCTCCCGACAAGATTTGACGCAGCTACGACCGGATCAAATCTGCATCTATCGATCG
GGTAATGACTCATGCCCGGAGAAGCGGACGATGCTCTACGTGTCTGAGTACAAGGCACCCCACAAGCTCACAGCT
CCGCACCTCCGCGACGGACTGCAGCAAATGAACGATATCCACAAGGAAGTCGTCAATCGGACCACGATCCCAGCA
GCTGACGTCGACCCGGCCGGCAATTTCAAGTATCACGCCGAAAGACTGACGGCATCTGCCCTCGCACAGACCTAT
CACTACATGATCGAGGGCGGCCTCGAGTACGGGCTGATGACGACTGGCGAGGCCATTGTCTTTCTCAAGGTGGAC
TGGAAAGAGCCTGAGACTCTATATTTCCACTTGTCTGAGCCTGGGCCGGAGGTGGAGAAGTATGAAGAGCGTGTG
CAGTTCAGCTCTGCCGTCGGACAGTATCTCGCCTTTACCCTTATGGCGCTCGGTAAGCCGGGCGAACATGTGGAA
CACCCTCAGGATGAGCGTGATCAAGTCAAGGCTAGGCTCAAAAGGTGGGCTGTCGATTTCGAACTTGCATTGCGA
TCGATTCCGGAAACCGAACGAAGGCCGCCGGACAGCGCGTCTAGCTGGGCACCTACGACACACGACGACTTTGAA
CTGTCGCCGATAAATCTGAAGGGGGGGAGATTCCGTCCAGGTAGAGGATGTGACGACAGGAACAAATATGCCCGA
AGACGAGACGAGTCAGAATCATCGGATGACGAGTCTGGAGGCGGGCCCCCGGATCCGTCGAGTCCCTCTGAGCAG
CGGCGACGACGAGCCGATGCAAACCGGGCTCGAAAGCGTGAAGAAAATCAGGCGCAGCAACCACGCCAAGGGACC
GGTGATGAAGGGCAACGCCGGTACTGCACACAAGCATGCCTCCTTGGACTGGTTCGGGGAGGCGCCATGGATCCT
CGTTGCCCCAACGCCGAGTGTCACGACGGGCCCCGAGGACGCACTCGTGCGCCACATCCCATCAGTCATTCTACA
TGGCTGCAACTTCTGCGTGAGCAGATGCGACGGACGCTGGATGGCGGCATCACGAAGCTAGGAAAGTCCGGTGCT
CGGGGAGTGCTTTTCAAGGTGACGCTGCTGTCGCACGGCTACACCTTCGTGTGCAAGGGCACAGTCGAGGCCTTC
ATCCCAGACCTTGAGCACGAAGCGGCCGTCTACAAGCGTCTCGAGCGGGTTCAGGGCGTCCACGTGCCGGTCTTT
CTGGGTGCCGTAGACCTCCGGCCGCTGAAGAGGACCTACTACTACGACTTCCGGGTTTACATTGTCCACATGACG
TTGCTTTCCTGGGCAGGAGACGAGATGGGCGACGTCAAGGCGACGAGAATGCTCGAGGCCAAGGCGGCCGCATCC
CTACAGGCTATGCACAACCAAGGTGTAGTGCACAGAGACGTGCGAAGGTTCAACATGCTGTTCAACGAGGAAACG
CAGAGCGTGATGATGATCGACTTCGAGCGCGCCGTCTTGCTGAAGCCACTGCGACGGTGCCTCGTCCAGACGTCG
CCCAACAAGAGAAAATCGGAGCCGGCCAACACGACGACTTCAGCCAAAGGCAGCAGCGGCAAAGCGAGCGGTTGG
CGAGAGGTCATGAAAGCTGCATTGGCCGAGGATAAGCGGATGCTGAGGGGGACGTTCCTGGAGCTGGAGAGGTGC
TGCCGATGA
Gene >Ophio5|1993
ATGGAACAGCGGATAAGCCTTCTCAATACTCTCTCCGAAAGCCTGCCTGTCGGCGCTCAGTACTTTGAGAGCCGG
AACCTCCTAGCCGGCTTAGGAAAGAGATTGTCGAAGCGAAAGATAGCAGATGAAAGGACACTTGAATACTTTATG
CATCTCAGCATCGAGGATCCGGTTAGAGCCATCGTCGAACAAGTTTCACAGATTGACAAGGTGCGCGAGCTATTC
GACATGGGAAATGGCATCGTCTTCGAGAACCACCCTCACGCCATCAGCGACATTGGCGAGGAAGTGCTTGCTCGG
GTGCCGCCATCAACACCGCCCTCCCGACAAGATTTGACGCAGCTACGACCGGATCAAATCTGCATCTATCGATCG
GGTAATGACTCATGCCCGGAGAAGCGGACGATGCTCTACGTGTCTGAGTACAAGGCACCCCACAAGCTCACAGCT
CCGCACCTCCGCGACGGACTGCAGCAAATGAACGATATCCACAAGGAAGTCGTCAATCGGACCACGATCCCAGCA
GCTGACGTCGACCCGGCCGGCAATTTCAAGTATCACGCCGAAAGACTGACGGCATCTGCCCTCGCACAGACCTAT
CACTACATGATCGAGGGCGGCCTCGAGTACGGGCTGATGACGACTGGCGAGGCCATTGTCTTTCTCAAGGTGGAC
TGGAAAGAGCCTGAGACTCTATATTTCCACTTGTCTGAGCCTGGGCCGGAGGTGGAGAAGTATGAAGAGCGTGTG
CAGTTCAGCTCTGCCGTCGGACAGTATCTCGCCTTTACCCTTATGGCGCTCGGTAAGCCGGGCGAACATGTGGAA
CACCCTCAGGATGAGCGTGATCAAGTCAAGGCTAGGCTCAAAAGGTGGGCTGTCGATTTCGAACTTGCATTGCGA
TCGATTCCGGAAACCGAACGAAGGCCGCCGGACAGCGCGTCTAGCTGGGCACCTACGACACACGACGACTTTGAA
CTGTCGCCGATAAATCTGAAGGGGGGGAGATTCCGTCCAGGTAGAGGATGTGACGACAGGAACAAATATGCCCGA
AGACGAGACGAGTCAGAATCATCGGATGACGAGTCTGGAGGCGGGCCCCCGGATCCGTCGAGTCCCTCTGAGCAG
CGGCGACGACGAGCCGATGCAAACCGGGCTCGAAAGCGTGAAGAAAATCAGGCGCAGCAACCACGCCAAGGGACC
GGTGATGAAGGGCAACGCCGGTACTGCACACAAGCATGCCTCCTTGGACTGGTTCGGGGAGGCGCCATGGATCCT
CGTTGCCCCAACGCCGAGTGTCACGACGGGCCCCGAGGACGCACTCGTGCGCCACATCCCATCAGTCATTCTACA
TGGCTGCAACTTCTGCGTGAGCAGATGCGACGGACGCTGGATGGCGGCATCACGAAGCTAGGAAAGTCCGGTGCT
CGGGGAGTGCTTTTCAAGGTGACGCTGCTGTCGCACGGCTACACCTTCGTGTGCAAGGGCACAGTCGAGGCCTTC
ATCCCAGACCTTGAGCACGAAGCGGCCGTCTACAAGCGTCTCGAGCGGGTTCAGGGCGTCCACGTGCCGGTCTTT
CTGGGTGCCGTAGACCTCCGGCCGCTGAAGAGGACCTACTACTACGACTTCCGGGTTTACATTGTCCACATGACG
TTGCTTTCCTGGGCAGGAGACGAGATGGGCGACGTCAAGGCGACGAGAATGCTCGAGGCCAAGGCGGCCGCATCC
CTACAGGCTATGCACAACCAAGGTGTAGTGCACAGAGACGTGCGAAGGTTCAACATGCTGTTCAACGAGGAAACG
CAGAGCGTGATGATGATCGACTTCGAGCGCGCCGTCTTGCTGAAGCCACTGCGACGGTGCCTCGTCCAGACGTCG
CCCAACAAGAGAAAATCGGAGCCGGCCAACACGACGACTTCAGCCAAAGGCAGCAGCGGCAAAGCGAGCGGTTGG
CGAGAGGTCATGAAAGCTGCATTGGCCGAGGATAAGCGGATGCTGAGGGGGACGTTCCTGGAGCTGGAGAGGTGC
TGCCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail