Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1986
Gene name
Locationscaffold_179:23466..24906
Strand-
Gene length (bp)1440
Transcript length (bp)1095
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 7.0E-21 140 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 89 303 4.0E-20
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 89 294 7.0E-19
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 89 298 5.0E-18
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 112 315 8.0E-17
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 133 329 9.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 89 303 4.0E-20
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 89 294 7.0E-19
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 89 298 5.0E-18
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 112 315 8.0E-17
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 133 329 9.0E-17
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 130 313 1.0E-16
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 138 332 1.0E-16
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 112 326 1.0E-15
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 98 302 1.0E-14
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 120 314 3.0E-14
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 43 303 7.0E-14
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 156 313 5.0E-13
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 120 301 6.0E-11
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 120 301 7.0E-11
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 105 301 1.0E-10
sp|Q61469|PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus GN=Plpp1 PE=1 SV=1 61 291 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 102 124 22
3 137 156 19
4 212 234 22
5 247 269 22
6 279 298 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1986
MCRQGREDQEDISQRPDSRTNSGQQGMAPPGNGPASRRGGAIWAASREWVMFNGVDCLSLMVLGGVTFAIYHSDV
PLMRTFPITFSGSGDVVYPDWAYPFRGWIMPSWCSGVVAIGGPIVVYLAAQVRLKSLSDASCAVLGSITAVVLAS
FFQVVLKQLVGGFRPYFLDVCMPDVNRVMANRSGLNRVGFHGLMFTTEVCTQPDAGKLKTAITSFPSGHTSATCA
GFGFVFFWLNAKLKVWADYRPAFWKLFLTLLPVLLCAIISCLLTVDAAHNWYDVVGGAVIGFTMAMASYRTSYAA
LWDWRFNHVPLRQKEAFSYAPGGEDTALTLTQKAGWGGTRAWLPHHVDSAATSTAFVADPANEP
Coding >Ophio5|1986
ATGTGTAGACAAGGCCGGGAAGACCAGGAAGACATCAGCCAGCGACCCGACAGTAGGACCAACAGTGGGCAACAA
GGCATGGCTCCTCCGGGCAACGGGCCGGCGTCAAGGCGAGGCGGTGCCATCTGGGCCGCTTCGAGGGAGTGGGTC
ATGTTCAACGGCGTCGACTGCCTGTCCCTGATGGTGCTCGGCGGCGTCACATTCGCGATCTACCACTCCGACGTG
CCCCTGATGAGGACTTTTCCCATCACCTTCTCCGGCTCAGGTGATGTCGTCTATCCGGATTGGGCGTATCCCTTC
CGCGGCTGGATCATGCCCTCTTGGTGTTCGGGCGTCGTCGCCATTGGCGGACCGATAGTTGTTTATTTGGCGGCT
CAGGTCCGGCTCAAGTCTCTGTCCGACGCCAGCTGTGCCGTCTTGGGATCCATCACGGCTGTCGTCTTGGCTTCG
TTTTTTCAGGTGGTGCTCAAGCAGCTCGTCGGCGGCTTCAGGCCTTACTTTCTCGATGTTTGTATGCCGGATGTG
AACCGGGTCATGGCCAATCGGTCGGGTCTCAACCGGGTTGGCTTCCATGGCCTCATGTTCACCACCGAGGTCTGC
ACGCAGCCTGACGCTGGAAAGCTCAAGACGGCCATCACCAGCTTCCCCAGCGGTCATACCTCTGCCACGTGCGCC
GGCTTCGGCTTCGTCTTTTTCTGGCTCAATGCCAAGCTCAAGGTCTGGGCTGACTACCGACCGGCTTTCTGGAAG
CTCTTCCTGACGCTGTTGCCGGTGCTGCTGTGCGCCATCATCTCGTGCTTGCTCACCGTCGACGCCGCTCACAAC
TGGTACGACGTCGTCGGCGGTGCCGTCATTGGCTTCACCATGGCCATGGCCTCTTACAGGACTTCGTACGCTGCC
CTCTGGGACTGGCGCTTCAACCACGTGCCCCTTCGTCAAAAGGAAGCCTTCTCCTACGCTCCCGGTGGCGAAGAC
ACCGCTCTCACTCTTACGCAGAAAGCCGGATGGGGGGGGACGAGGGCTTGGCTGCCTCATCATGTCGACAGTGCT
GCCACTAGTACTGCCTTTGTCGCTGACCCGGCCAACGAGCCC
Transcript >Ophio5|1986
ATGTGTAGACAAGGCCGGGAAGACCAGGAAGACATCAGCCAGCGACCCGACAGTAGGACCAACAGTGGGCAACAA
GGCATGGCTCCTCCGGGCAACGGGCCGGCGTCAAGGCGAGGCGGTGCCATCTGGGCCGCTTCGAGGGAGTGGGTC
ATGTTCAACGGCGTCGACTGCCTGTCCCTGATGGTGCTCGGCGGCGTCACATTCGCGATCTACCACTCCGACGTG
CCCCTGATGAGGACTTTTCCCATCACCTTCTCCGGCTCAGGTGATGTCGTCTATCCGGATTGGGCGTATCCCTTC
CGCGGCTGGATCATGCCCTCTTGGTGTTCGGGCGTCGTCGCCATTGGCGGACCGATAGTTGTTTATTTGGCGGCT
CAGGTCCGGCTCAAGTCTCTGTCCGACGCCAGCTGTGCCGTCTTGGGATCCATCACGGCTGTCGTCTTGGCTTCG
TTTTTTCAGGTGGTGCTCAAGCAGCTCGTCGGCGGCTTCAGGCCTTACTTTCTCGATGTTTGTATGCCGGATGTG
AACCGGGTCATGGCCAATCGGTCGGGTCTCAACCGGGTTGGCTTCCATGGCCTCATGTTCACCACCGAGGTCTGC
ACGCAGCCTGACGCTGGAAAGCTCAAGACGGCCATCACCAGCTTCCCCAGCGGTCATACCTCTGCCACGTGCGCC
GGCTTCGGCTTCGTCTTTTTCTGGCTCAATGCCAAGCTCAAGGTCTGGGCTGACTACCGACCGGCTTTCTGGAAG
CTCTTCCTGACGCTGTTGCCGGTGCTGCTGTGCGCCATCATCTCGTGCTTGCTCACCGTCGACGCCGCTCACAAC
TGGTACGACGTCGTCGGCGGTGCCGTCATTGGCTTCACCATGGCCATGGCCTCTTACAGGACTTCGTACGCTGCC
CTCTGGGACTGGCGCTTCAACCACGTGCCCCTTCGTCAAAAGGAAGCCTTCTCCTACGCTCCCGGTGGCGAAGAC
ACCGCTCTCACTCTTACGCAGAAAGCCGGATGGGGGGGGACGAGGGCTTGGCTGCCTCATCATGTCGACAGTGCT
GCCACTAGTACTGCCTTTGTCGCTGACCCGGCCAACGAGCCCTAG
Gene >Ophio5|1986
ATGTGTAGGTAGGTAGAGGTAGGTAGGTAGATGCAGGAAAAGGCTGCAGGCGGCGTCATTTGTCATGTGCAGCTG
CCCGTGACGTCAACCGAGGACGGACCTGCCCTGGTCACCTCGTTACCTAGGTCCCTACAGAAGTGAAGGTGATGA
CGGATCATGACTTCGTTGCCATAGATTCAGAGGTAGGTAAATAGTTAGGCAGTCTTTTCTCCCCCCTTCGTCTTC
CTCCATCAGTCCTGTGTCCTCTCGCCATCTGGCCTCTCCAGCACGCACACCTATAACCCACCAGCAGACAAGGCC
GGGAAGACCAGGAAGACATCAGCCAGCGACCCGACAGTAGGACCAACAGTGGGCAACAAGGCATGGCTCCTCCGG
GCAACGGGCCGGCGTCAAGGCGAGGCGGTGCCATCTGGGCCGCTTCGAGGGAGTGGGTCATGTTCAACGGCGTCG
ACTGCCTGTCCCTGATGGTGCTCGGCGGCGTCACATTCGCGGTACGCCTCTTTCGGTCTTCCCCCCTTCCTCCCC
TTGGACTATAACTGACAGGGCTCGCAGATCTACCACTCCGACGTGCCCCTGATGAGGACTTTTCCCATCACCTTC
TCCGGCTCAGGTGATGTCGTCTATCCGGATTGGGCGTATCCCTTCCGCGGCTGGATCATGCCCTCTTGGTGTTCG
GGCGTCGTCGCCATTGGCGGACCGATAGTTGTTTATTTGGCGGCTCAGGTCCGGCTCAAGTCTCTGTCCGACGCC
AGCTGTGCCGTCTTGGGATCCATCACGGCTGTCGTCTTGGCTTCGTTTTTTCAGGTGGTGCTCAAGCAGCTCGTC
GGCGGCTTCAGGCCTTACTTTCTCGATGTTTGTATGCCGGATGTGAACCGGGTCATGGCCAATCGGTCGGGTCTC
AACCGGGTTGGCTTCCATGGCCTCATGTTCACCACCGAGGTCTGCACGCAGCCTGACGCTGGAAAGCTCAAGACG
GCCATCACCAGCTTCCCCAGCGGTCATACCTCTGCCACGTGCGCCGGCTTCGGCTTCGTCTTTTTCTGGCTCAAT
GCCAAGCTCAAGGTCTGGGCTGACTACCGACCGGCTTTCTGGAAGCTCTTCCTGACGCTGTTGCCGGTGCTGCTG
TGCGCCATCATCTCGTGCTTGCTCACCGTCGACGCCGCTCACAACTGGTACGACGTCGTCGGCGGTGCCGTCATT
GGCTTCACCATGGCCATGGCCTCTTACAGGACTTCGTACGCTGCCCTCTGGGACTGGCGCTTCAACCACGTGCCC
CTTCGTCAAAAGGAAGCCTTCTCCTACGCTCCCGGTGGCGAAGACACCGCTCTCACTCTTACGCAGAAAGCCGGA
TGGGGGGGGACGAGGGCTTGGCTGCCTCATCATGTCGACAGTGCTGCCACTAGTACTGCCTTTGTCGCTGACCCG
GCCAACGAGCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail