Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1983
Gene name
Locationscaffold_179:14285..14971
Strand-
Gene length (bp)686
Transcript length (bp)531
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16015 Promethin Promethin 2.0E-28 45 147

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 70 92 22
2 97 119 22
3 129 148 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 108.30 54.40 162.20
CcL In ants, during behavior modification 21.24 6.68 35.81
CcD In ants, recently dead 41.68 17.21 66.15

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000535 yes
CcL CcD 0.041816 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1983
MASSQDEGGQQQQQQQQYSIPNPQSNGLSHLAASEVDAGLFQRCLDYVVAPSSRRRAYDYASSVASSRPILFSLV
ASQLLFSFLPLLLFVAFAAATVAFALGAAVLFALFWVAFALLLLLPALLVASSIALLVWAWALFSFFVARWVWTN
ANGAAAAKQDHHRHGIKAETKAENGD
Coding >Ophio5|1983
ATGGCCTCCTCGCAAGACGAAGGCGGCCAGCAGCAGCAGCAGCAGCAGCAGTACAGCATTCCCAACCCGCAGAGC
AACGGCCTCTCTCATCTCGCCGCCTCCGAAGTCGACGCAGGTCTCTTTCAGCGCTGTCTCGATTACGTAGTCGCT
CCGTCTTCTCGCCGTCGCGCATACGACTACGCCTCGTCCGTCGCCTCGTCGCGGCCGATCCTCTTCTCACTTGTC
GCCTCGCAGCTACTCTTCTCCTTCCTCCCCCTTCTCCTCTTCGTCGCCTTCGCCGCCGCTACCGTCGCCTTCGCT
CTCGGCGCCGCCGTCCTCTTCGCCCTCTTTTGGGTCGCTTTCGCCCTCCTCCTTCTCCTGCCAGCTTTGCTCGTC
GCCTCTTCCATCGCCTTGCTCGTTTGGGCTTGGGCTTTGTTCAGCTTCTTCGTCGCTCGCTGGGTCTGGACCAAC
GCCAACGGCGCCGCGGCCGCGAAGCAAGACCATCACCGCCATGGCATCAAGGCCGAGACCAAGGCCGAGAACGGG
GAT
Transcript >Ophio5|1983
ATGGCCTCCTCGCAAGACGAAGGCGGCCAGCAGCAGCAGCAGCAGCAGCAGTACAGCATTCCCAACCCGCAGAGC
AACGGCCTCTCTCATCTCGCCGCCTCCGAAGTCGACGCAGGTCTCTTTCAGCGCTGTCTCGATTACGTAGTCGCT
CCGTCTTCTCGCCGTCGCGCATACGACTACGCCTCGTCCGTCGCCTCGTCGCGGCCGATCCTCTTCTCACTTGTC
GCCTCGCAGCTACTCTTCTCCTTCCTCCCCCTTCTCCTCTTCGTCGCCTTCGCCGCCGCTACCGTCGCCTTCGCT
CTCGGCGCCGCCGTCCTCTTCGCCCTCTTTTGGGTCGCTTTCGCCCTCCTCCTTCTCCTGCCAGCTTTGCTCGTC
GCCTCTTCCATCGCCTTGCTCGTTTGGGCTTGGGCTTTGTTCAGCTTCTTCGTCGCTCGCTGGGTCTGGACCAAC
GCCAACGGCGCCGCGGCCGCGAAGCAAGACCATCACCGCCATGGCATCAAGGCCGAGACCAAGGCCGAGAACGGG
GATTGA
Gene >Ophio5|1983
ATGGCCTCCTCGCAAGACGAAGGCGGCCAGCAGCAGCAGCAGCAGCAGCAGTACAGCATTCCCAACCCGCAGAGC
AACGGCCTCTCTCATCTCGCCGCCTCCGAAGTCGACGCAGGTCTCTTTCAGCGCTGTCTCGATTACGTAGTCGCT
CCGTCTTCTCGCCGTCGCGCATACGACTACGCCTCGTCCGTCGCCTCGTCGCGGCCGATCCTCTTCGTCCGTATA
CCCTCTCTCTCTCTCTCTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNTCTCTCTCTCTCTCTCTCCTTGTTCCATCTAGACAACTGACCCTCTGGAGCAGTCAC
TTGTCGCCTCGCAGCTACTCTTCTCCTTCCTCCCCCTTCTCCTCTTCGTCGCCTTCGCCGCCGCTACCGTCGCCT
TCGCTCTCGGCGCCGCCGTCCTCTTCGCCCTCTTTTGGGTCGCTTTCGCCCTCCTCCTTCTCCTGCCAGCTTTGC
TCGTCGCCTCTTCCATCGCCTTGCTCGTTTGGGCTTGGGCTTTGTTCAGCTTCTTCGTCGCTCGCTGGGTCTGGA
CCAACGCCAACGGCGCCGCGGCCGCGAAGCAAGACCATCACCGCCATGGCATCAAGGCCGAGACCAAGGCCGAGA
ACGGGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail