Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|197
Gene name
Locationscaffold_1030:234..2152
Strand+
Gene length (bp)1918
Transcript length (bp)1740
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01595 CNNM Cyclin M transmembrane N-terminal domain 2.5E-33 55 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 40 404 7.0E-153
sp|Q9USJ3|YJ23_SCHPO Uncharacterized protein C4B3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.03c PE=1 SV=1 24 388 3.0E-125
sp|Q9LTD8|Y5279_ARATH DUF21 domain-containing protein At5g52790 OS=Arabidopsis thaliana GN=CBSDUF5 PE=2 SV=2 36 385 3.0E-66
sp|Q5U2P1|CNNM2_RAT Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1 46 380 7.0E-64
sp|Q3TWN3|CNNM2_MOUSE Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=3 46 380 8.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 40 404 7.0E-153
sp|Q9USJ3|YJ23_SCHPO Uncharacterized protein C4B3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.03c PE=1 SV=1 24 388 3.0E-125
sp|Q9LTD8|Y5279_ARATH DUF21 domain-containing protein At5g52790 OS=Arabidopsis thaliana GN=CBSDUF5 PE=2 SV=2 36 385 3.0E-66
sp|Q5U2P1|CNNM2_RAT Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1 46 380 7.0E-64
sp|Q3TWN3|CNNM2_MOUSE Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=3 46 380 8.0E-64
sp|Q9H8M5|CNNM2_HUMAN Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=1 SV=2 46 380 1.0E-63
sp|A0JPA0|CNNM4_XENTR Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1 46 380 3.0E-62
sp|P0C588|CNNM4_RAT Metal transporter CNNM4 OS=Rattus norvegicus GN=Cnnm4 PE=1 SV=1 39 380 6.0E-61
sp|Q69ZF7|CNNM4_MOUSE Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 PE=1 SV=2 39 380 9.0E-61
sp|Q6P4Q7|CNNM4_HUMAN Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 PE=1 SV=3 39 380 2.0E-60
sp|Q8VZI2|Y4370_ARATH DUF21 domain-containing protein At4g33700 OS=Arabidopsis thaliana GN=CBSDUF6 PE=1 SV=1 45 343 6.0E-58
sp|Q8RY60|Y1733_ARATH DUF21 domain-containing protein At1g47330 OS=Arabidopsis thaliana GN=CBSDUF7 PE=1 SV=1 42 374 3.0E-56
sp|Q9ZQR4|Y2452_ARATH DUF21 domain-containing protein At2g14520 OS=Arabidopsis thaliana GN=CBSDUF3 PE=2 SV=2 45 343 1.0E-55
sp|Q4V3C7|Y4423_ARATH DUF21 domain-containing protein At4g14230 OS=Arabidopsis thaliana GN=CBSDUF2 PE=2 SV=1 48 352 6.0E-54
sp|Q9ZVS8|Y1327_ARATH Putative DUF21 domain-containing protein At1g03270 OS=Arabidopsis thaliana GN=CBSDUF4 PE=4 SV=2 27 340 7.0E-53
sp|Q67XQ0|Y4424_ARATH DUF21 domain-containing protein At4g14240 OS=Arabidopsis thaliana GN=CBSDUF1 PE=1 SV=1 48 340 3.0E-52
sp|Q0GA42|CNNM1_MOUSE Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 PE=1 SV=5 75 400 2.0E-36
sp|Q9NRU3|CNNM1_HUMAN Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 PE=2 SV=3 75 400 4.0E-36
sp|Q8NE01|CNNM3_HUMAN Metal transporter CNNM3 OS=Homo sapiens GN=CNNM3 PE=1 SV=1 135 380 7.0E-23
sp|Q32NY4|CNNM3_MOUSE Metal transporter CNNM3 OS=Mus musculus GN=Cnnm3 PE=1 SV=2 134 380 1.0E-22
sp|Q9LK65|Y3307_ARATH Putative DUF21 domain-containing protein At3g13070, chloroplastic OS=Arabidopsis thaliana GN=CBSDUFCH1 PE=3 SV=1 97 383 7.0E-14
sp|Q84R21|Y1559_ARATH DUF21 domain-containing protein At1g55930, chloroplastic OS=Arabidopsis thaliana GN=CBSDUFCH2 PE=2 SV=2 109 383 9.0E-14
sp|P74078|Y1254_SYNY3 UPF0053 protein sll1254 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1254 PE=3 SV=1 142 396 1.0E-13
sp|P54505|YQHB_BACSU UPF0053 protein YqhB OS=Bacillus subtilis (strain 168) GN=yqhB PE=3 SV=1 119 376 6.0E-13
sp|O07585|YHDP_BACSU UPF0053 protein YhdP OS=Bacillus subtilis (strain 168) GN=yhdP PE=3 SV=1 142 388 6.0E-13
sp|P54428|YRKA_BACSU UPF0053 protein YrkA OS=Bacillus subtilis (strain 168) GN=yrkA PE=3 SV=2 113 376 2.0E-12
sp|Q8K9C0|CORC_BUCAP Magnesium and cobalt efflux protein CorC OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=corC PE=3 SV=1 221 376 1.0E-10
sp|P37908|YFJD_ECOLI UPF0053 inner membrane protein YfjD OS=Escherichia coli (strain K12) GN=yfjD PE=1 SV=5 91 369 7.0E-10
sp|O05241|YUGS_BACSU UPF0053 protein YugS OS=Bacillus subtilis (strain 168) GN=yugS PE=3 SV=2 135 376 2.0E-09
sp|O07589|YHDT_BACSU UPF0053 protein YhdT OS=Bacillus subtilis (strain 168) GN=yhdT PE=3 SV=1 142 376 3.0E-09
sp|Q54318|HLYC_BRAHO Hemolysin C OS=Brachyspira hyodysenteriae GN=tlyC PE=3 SV=1 224 369 5.0E-09
sp|P0A2L3|CORC_SALTY Magnesium and cobalt efflux protein CorC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=corC PE=1 SV=1 221 368 1.0E-08
sp|P0A2L4|CORC_SALTI Magnesium and cobalt efflux protein CorC OS=Salmonella typhi GN=corC PE=3 SV=1 221 368 1.0E-08
sp|O05961|HLYC_RICPR Hemolysin C OS=Rickettsia prowazekii (strain Madrid E) GN=tlyC PE=2 SV=1 221 380 3.0E-08
sp|P0AE81|CORC_SHIFL Magnesium and cobalt efflux protein CorC OS=Shigella flexneri GN=corC PE=3 SV=1 224 368 3.0E-08
sp|P0AE78|CORC_ECOLI Magnesium and cobalt efflux protein CorC OS=Escherichia coli (strain K12) GN=corC PE=1 SV=1 224 368 3.0E-08
sp|P0AE79|CORC_ECOL6 Magnesium and cobalt efflux protein CorC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=corC PE=3 SV=1 224 368 3.0E-08
sp|P0AE80|CORC_ECO57 Magnesium and cobalt efflux protein CorC OS=Escherichia coli O157:H7 GN=corC PE=3 SV=1 224 368 3.0E-08
sp|P57518|CORC_BUCAI Magnesium and cobalt efflux protein CorC OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=corC PE=3 SV=1 221 368 4.0E-08
sp|A8EZU0|HLYC_RICCK Possible hemolysin C OS=Rickettsia canadensis (strain McKiel) GN=tlyC PE=3 SV=1 221 380 7.0E-08
sp|Q67XQ0|Y4424_ARATH DUF21 domain-containing protein At4g14240 OS=Arabidopsis thaliana GN=CBSDUF1 PE=1 SV=1 331 386 2.0E-07
sp|Q92GI2|HLYC_RICCN Hemolysin C homolog OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tlyC PE=3 SV=1 221 380 3.0E-07
sp|Q4UK99|HLYC_RICFE Hemolysin C OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tlyC PE=3 SV=1 221 442 3.0E-07
sp|A8GTI4|HLYC_RICRS Hemolysin C homolog OS=Rickettsia rickettsii (strain Sheila Smith) GN=tlyC PE=3 SV=1 221 380 3.0E-07
sp|Q4V3C7|Y4423_ARATH DUF21 domain-containing protein At4g14230 OS=Arabidopsis thaliana GN=CBSDUF2 PE=2 SV=1 350 397 5.0E-07
sp|P9WFP3|Y1842_MYCTU UPF0053 protein Rv1842c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1842c PE=1 SV=1 137 376 4.0E-06
sp|A8GPR9|HLYC_RICAH Possible hemolysin C OS=Rickettsia akari (strain Hartford) GN=tlyC PE=3 SV=1 222 380 4.0E-06
sp|A8F2M1|HLYC_RICM5 Hemolysin C homolog OS=Rickettsia massiliae (strain Mtu5) GN=tlyC PE=3 SV=2 221 380 5.0E-06
sp|P9WFP2|Y1842_MYCTO UPF0053 protein MT1890 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1890 PE=3 SV=1 137 376 5.0E-06
sp|A8GUH1|HLYC_RICB8 Possible hemolysin C OS=Rickettsia bellii (strain OSU 85-389) GN=tlyC PE=3 SV=1 215 376 5.0E-06
sp|Q9ZVS8|Y1327_ARATH Putative DUF21 domain-containing protein At1g03270 OS=Arabidopsis thaliana GN=CBSDUF4 PE=4 SV=2 348 383 6.0E-06
sp|Q57017|Y107_HAEIN UPF0053 protein HI_0107 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0107 PE=1 SV=2 46 369 8.0E-06
sp|Q1RGX2|HLYC_RICBR Possible hemolysin C OS=Rickettsia bellii (strain RML369-C) GN=tlyC PE=3 SV=1 215 376 9.0E-06
sp|Q9CM13|CORC_PASMU Magnesium and cobalt efflux protein CorC OS=Pasteurella multocida (strain Pm70) GN=corC PE=3 SV=1 221 368 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 47 69 22
3 130 152 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|197
MRRHGSSGAFTNLRPVVLGLGRLLGVAAAPLAARAAAEDDDGSDTPLWVLAVASMTLVLLGGAFAGLTIAFMGQD
SIYLQVLSGDPVEPQHRNAKRVLNLLNRGKHWVLVTLLLANVIVNESLPVVLDRTLGGGVAAVVGSTVLIVIFGE
IVPQSICVRFGLPIGGYMSKPVLVLMYLLSPVAWPTAKLLDWILGEDHGTVYKKSGLKTLVTLHKSLGDLSERLN
QDEVTIITAVLDLKDKPVSEVMTPMDDVFTLAEDHVLDEKTMDTILSSGYSRIPIYRAGNRTDFVGMLLVKTLIT
YDPEDRIPVRDVQLGAIVETRPETSCLDIINFFQEGKSHMVLVSEYPGSDRGALGVVTLEDVIEELIGEEIVDES
DVYVDVHKAIRRLTPAPRAKRLHHDDTAATSTAAVAVKKPGEGSVLVDIAEHPDGQVVTMGSPGALSDTGAVAEH
HPKTAIFMKRRSSAGPDGKAENGTVPVKASLDEMRRQLRLGPANRAARPRNTRTNVFKIKQGLGVTTGTGSNGKL
VAKAAAAAATADDGEETPLLAQRPTVNGGRPSAASYGSGQSASKQGGSAAAGDE
Coding >Ophio5|197
ATGAGGAGACATGGTTCCTCTGGAGCCTTTACCAACTTGAGGCCCGTCGTCCTCGGCCTCGGACGACTGCTGGGC
GTCGCAGCCGCGCCGCTGGCTGCACGCGCCGCGGCTGAAGATGACGATGGCAGTGACACTCCCCTCTGGGTCCTG
GCCGTCGCCTCCATGACGCTCGTCCTGCTGGGAGGCGCATTTGCCGGCCTGACCATCGCCTTCATGGGCCAGGAC
AGCATCTATCTCCAGGTTTTGTCTGGAGATCCCGTAGAGCCGCAGCATAGGAATGCCAAGAGGGTCCTCAATCTG
CTCAACAGGGGCAAGCATTGGGTCCTCGTCACCCTGCTGCTGGCCAACGTCATTGTCAACGAGTCGCTCCCCGTT
GTCCTCGACCGCACCCTCGGCGGCGGCGTCGCAGCTGTCGTCGGCAGTACGGTTCTCATCGTCATCTTTGGCGAA
ATCGTTCCCCAGTCCATCTGCGTTCGATTCGGCCTGCCCATCGGCGGCTACATGTCGAAACCCGTCCTCGTCCTC
ATGTACTTGCTGAGCCCCGTCGCCTGGCCCACCGCCAAGCTTCTCGACTGGATCCTCGGCGAGGATCACGGGACC
GTGTACAAGAAGAGCGGCCTCAAGACGCTAGTGACGCTGCACAAGTCGTTGGGCGATTTGTCGGAGCGGCTGAAC
CAGGATGAGGTCACCATCATCACCGCCGTCCTCGACCTGAAAGACAAGCCGGTGTCCGAGGTGATGACGCCCATG
GACGACGTCTTCACACTTGCTGAGGATCACGTCCTCGACGAAAAGACCATGGACACGATCCTGTCGTCGGGCTAC
TCGAGGATTCCCATCTATCGCGCGGGCAACCGGACCGACTTTGTTGGCATGCTGCTTGTCAAGACACTCATCACC
TACGACCCGGAGGACCGGATACCGGTTAGAGACGTGCAGCTGGGCGCCATCGTCGAGACGCGGCCGGAGACGAGC
TGTCTCGACATTATCAATTTCTTCCAGGAGGGGAAATCTCACATGGTGCTGGTGTCTGAGTACCCAGGATCGGAC
CGCGGCGCTCTGGGCGTCGTCACTCTCGAAGACGTCATCGAGGAGCTCATTGGAGAGGAAATCGTGGACGAATCG
GACGTGTACGTGGACGTACACAAGGCGATCCGACGCCTGACACCGGCGCCACGGGCCAAGCGGTTGCATCACGAC
GACACGGCGGCGACGTCGACGGCCGCCGTAGCGGTCAAGAAGCCCGGTGAAGGATCTGTCCTGGTGGACATTGCA
GAGCACCCGGACGGACAGGTTGTTACGATGGGCTCCCCGGGAGCGCTCAGCGACACGGGCGCCGTAGCGGAGCAC
CACCCGAAGACGGCCATCTTCATGAAGCGACGCAGCTCGGCGGGCCCAGACGGAAAGGCCGAGAACGGCACGGTG
CCGGTCAAGGCCTCACTGGATGAGATGAGGCGGCAGCTACGGCTAGGGCCGGCCAACCGCGCCGCCCGGCCTCGC
AACACGCGGACCAACGTTTTCAAGATTAAACAGGGACTGGGAGTGACGACGGGAACGGGCAGCAACGGGAAGCTG
GTCGCCAAGGCGGCGGCGGCGGCGGCAACTGCAGACGATGGCGAGGAGACGCCGCTACTGGCGCAGAGGCCGACA
GTCAACGGCGGTCGGCCCAGTGCTGCAAGCTACGGATCGGGACAGTCGGCCAGCAAGCAAGGAGGCAGCGCGGCA
GCAGGAGATGAG
Transcript >Ophio5|197
ATGAGGAGACATGGTTCCTCTGGAGCCTTTACCAACTTGAGGCCCGTCGTCCTCGGCCTCGGACGACTGCTGGGC
GTCGCAGCCGCGCCGCTGGCTGCACGCGCCGCGGCTGAAGATGACGATGGCAGTGACACTCCCCTCTGGGTCCTG
GCCGTCGCCTCCATGACGCTCGTCCTGCTGGGAGGCGCATTTGCCGGCCTGACCATCGCCTTCATGGGCCAGGAC
AGCATCTATCTCCAGGTTTTGTCTGGAGATCCCGTAGAGCCGCAGCATAGGAATGCCAAGAGGGTCCTCAATCTG
CTCAACAGGGGCAAGCATTGGGTCCTCGTCACCCTGCTGCTGGCCAACGTCATTGTCAACGAGTCGCTCCCCGTT
GTCCTCGACCGCACCCTCGGCGGCGGCGTCGCAGCTGTCGTCGGCAGTACGGTTCTCATCGTCATCTTTGGCGAA
ATCGTTCCCCAGTCCATCTGCGTTCGATTCGGCCTGCCCATCGGCGGCTACATGTCGAAACCCGTCCTCGTCCTC
ATGTACTTGCTGAGCCCCGTCGCCTGGCCCACCGCCAAGCTTCTCGACTGGATCCTCGGCGAGGATCACGGGACC
GTGTACAAGAAGAGCGGCCTCAAGACGCTAGTGACGCTGCACAAGTCGTTGGGCGATTTGTCGGAGCGGCTGAAC
CAGGATGAGGTCACCATCATCACCGCCGTCCTCGACCTGAAAGACAAGCCGGTGTCCGAGGTGATGACGCCCATG
GACGACGTCTTCACACTTGCTGAGGATCACGTCCTCGACGAAAAGACCATGGACACGATCCTGTCGTCGGGCTAC
TCGAGGATTCCCATCTATCGCGCGGGCAACCGGACCGACTTTGTTGGCATGCTGCTTGTCAAGACACTCATCACC
TACGACCCGGAGGACCGGATACCGGTTAGAGACGTGCAGCTGGGCGCCATCGTCGAGACGCGGCCGGAGACGAGC
TGTCTCGACATTATCAATTTCTTCCAGGAGGGGAAATCTCACATGGTGCTGGTGTCTGAGTACCCAGGATCGGAC
CGCGGCGCTCTGGGCGTCGTCACTCTCGAAGACGTCATCGAGGAGCTCATTGGAGAGGAAATCGTGGACGAATCG
GACGTGTACGTGGACGTACACAAGGCGATCCGACGCCTGACACCGGCGCCACGGGCCAAGCGGTTGCATCACGAC
GACACGGCGGCGACGTCGACGGCCGCCGTAGCGGTCAAGAAGCCCGGTGAAGGATCTGTCCTGGTGGACATTGCA
GAGCACCCGGACGGACAGGTTGTTACGATGGGCTCCCCGGGAGCGCTCAGCGACACGGGCGCCGTAGCGGAGCAC
CACCCGAAGACGGCCATCTTCATGAAGCGACGCAGCTCGGCGGGCCCAGACGGAAAGGCCGAGAACGGCACGGTG
CCGGTCAAGGCCTCACTGGATGAGATGAGGCGGCAGCTACGGCTAGGGCCGGCCAACCGCGCCGCCCGGCCTCGC
AACACGCGGACCAACGTTTTCAAGATTAAACAGGGACTGGGAGTGACGACGGGAACGGGCAGCAACGGGAAGCTG
GTCGCCAAGGCGGCGGCGGCGGCGGCAACTGCAGACGATGGCGAGGAGACGCCGCTACTGGCGCAGAGGCCGACA
GTCAACGGCGGTCGGCCCAGTGCTGCAAGCTACGGATCGGGACAGTCGGCCAGCAAGCAAGGAGGCAGCGCGGCA
GCAGGAGATGAGTGA
Gene >Ophio5|197
ATGAGGAGACATGGTTCCTCTGGAGCCTTTACCAACTTGAGGCCCGTCGTCCTCGGCCTCGGACGACTGCTGGGC
GTCGCAGCCGCGCCGCTGGCTGCACGCGCCGCGGCTGAAGATGACGATGGCAGTGACACTCCCCTCTGGGTCCTG
GCCGTCGCCTCCATGACGCTCGTCCTGCTGGGAGGCGCATTTGCCGGCCTGACCATCGCGTGAGTGTCAAGGTCT
CCAGCCTTGGCCGTCCAGAAGCATGCTGACGTGCAACTCCTTTAGCTTCATGGGCCAGGACAGCATCTATCTCCA
GGTTTTGTCTGGAGATCCCGTAGAGCCGCAGCATAGGAATGCCAAGAGGGTCCTCAATCTGCTCAACAGGGGCAA
GCATTGGGTCCTCGTCACCCTGCTGCTGGCCAACGTCATTGTCAACGAGTCGCTCCCCGTTGTCCTCGACCGCAC
CCTCGGCGGCGGCGTCGCAGCTGTCGTCGGCAGTACGGTTCTCATCGGTCCGTGACACTCTCCCACTCCGTTGCT
CTCTCTCTCTCGCATTAACCATTCACGCGCAGTCATCTTTGGCGAAATCGTTCCCCAGTCCATCTGCGTTCGATT
CGGCCTGCCCATCGGCGGCTACATGTCGAAACCCGTCCTCGTCCTCATGTACTTGCTGAGCCCCGTCGCCTGGCC
CACCGCCAAGCTTCTCGACTGGATCCTCGGCGAGGATCACGGGACCGTGTACAAGAAGAGCGGCCTCAAGACGCT
AGTGACGCTGCACAAGTCGTTGGGCGATTTGTCGGAGCGGCTGAACCAGGATGAGGTCACCATCATCACCGCCGT
CCTCGACCTGAAAGACAAGCCGGTGTCCGAGGTGATGACGCCCATGGACGACGTCTTCACACTTGCTGAGGATCA
CGTCCTCGACGAAAAGACCATGGACACGATCCTGTCGTCGGGCTACTCGAGGATTCCCATCTATCGCGCGGGCAA
CCGGACCGACTTTGTTGGCATGCTGCTTGTCAAGACACTCATCACCTACGACCCGGAGGACCGGATACCGGTTAG
AGACGTGCAGCTGGGCGCCATCGTCGAGACGCGGCCGGAGACGAGCTGTCTCGACATTATCAATTTCTTCCAGGA
GGGGAAATCTCACATGGTGCTGGTGTCTGAGTACCCAGGATCGGACCGCGGCGCTCTGGGCGTCGTCACTCTCGA
AGACGTCATCGAGGAGCTCATTGGAGAGTAAGTGACTGACGACGGCAGTGGCCTTTGGGACAAAGCGCGCTGACG
CCGCAGCAGGGAAATCGTGGACGAATCGGACGTGTACGTGGACGTACACAAGGCGATCCGACGCCTGACACCGGC
GCCACGGGCCAAGCGGTTGCATCACGACGACACGGCGGCGACGTCGACGGCCGCCGTAGCGGTCAAGAAGCCCGG
TGAAGGATCTGTCCTGGTGGACATTGCAGAGCACCCGGACGGACAGGTTGTTACGATGGGCTCCCCGGGAGCGCT
CAGCGACACGGGCGCCGTAGCGGAGCACCACCCGAAGACGGCCATCTTCATGAAGCGACGCAGCTCGGCGGGCCC
AGACGGAAAGGCCGAGAACGGCACGGTGCCGGTCAAGGCCTCACTGGATGAGATGAGGCGGCAGCTACGGCTAGG
GCCGGCCAACCGCGCCGCCCGGCCTCGCAACACGCGGACCAACGTTTTCAAGATTAAACAGGGACTGGGAGTGAC
GACGGGAACGGGCAGCAACGGGAAGCTGGTCGCCAAGGCGGCGGCGGCGGCGGCAACTGCAGACGATGGCGAGGA
GACGCCGCTACTGGCGCAGAGGCCGACAGTCAACGGCGGTCGGCCCAGTGCTGCAAGCTACGGATCGGGACAGTC
GGCCAGCAAGCAAGGAGGCAGCGCGGCAGCAGGAGATGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail