Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1953
Gene name
Locationscaffold_177:5781..7290
Strand-
Gene length (bp)1509
Transcript length (bp)1395
Coding sequence length (bp)1392
Protein length (aa) 464

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04095 NAPRTase Nicotinate phosphoribosyltransferase (NAPRTase) family 5.3E-48 183 441
PF17767 NAPRTase_N Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain 4.4E-37 17 149

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK3|NPT1_SCHPO Probable nicotinate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.06 PE=3 SV=1 12 440 2.0E-120
sp|P39683|NPT1_YEAST Nicotinate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPT1 PE=1 SV=3 13 456 1.0E-119
sp|Q8PSJ3|PNCB_METMA Nicotinate phosphoribosyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pncB PE=3 SV=1 13 433 1.0E-77
sp|Q8TMW6|PNCB_METAC Nicotinate phosphoribosyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pncB PE=3 SV=1 13 433 5.0E-75
sp|Q1QZ10|PNCB_CHRSD Nicotinate phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pncB PE=3 SV=1 15 445 2.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK3|NPT1_SCHPO Probable nicotinate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.06 PE=3 SV=1 12 440 2.0E-120
sp|P39683|NPT1_YEAST Nicotinate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPT1 PE=1 SV=3 13 456 1.0E-119
sp|Q8PSJ3|PNCB_METMA Nicotinate phosphoribosyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pncB PE=3 SV=1 13 433 1.0E-77
sp|Q8TMW6|PNCB_METAC Nicotinate phosphoribosyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pncB PE=3 SV=1 13 433 5.0E-75
sp|Q1QZ10|PNCB_CHRSD Nicotinate phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pncB PE=3 SV=1 15 445 2.0E-67
sp|Q12Z05|PNCB_METBU Nicotinate phosphoribosyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pncB PE=3 SV=1 13 433 8.0E-67
sp|C0QFM5|PNCB_DESAH Nicotinate phosphoribosyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=pncB PE=3 SV=1 13 450 1.0E-59
sp|B4EVC0|PNCB_PROMH Nicotinate phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=pncB PE=3 SV=1 13 438 7.0E-59
sp|A1WJL0|PNCB_VEREI Nicotinate phosphoribosyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pncB PE=3 SV=1 13 431 4.0E-58
sp|B7MS49|PNCB_ECO81 Nicotinate phosphoribosyltransferase OS=Escherichia coli O81 (strain ED1a) GN=pncB PE=3 SV=1 6 439 2.0E-57
sp|B7MHP0|PNCB_ECO45 Nicotinate phosphoribosyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pncB PE=3 SV=1 6 439 2.0E-57
sp|P18133|PNCB_ECOLI Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain K12) GN=pncB PE=1 SV=3 6 438 2.0E-57
sp|B1X8N5|PNCB_ECODH Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=pncB PE=3 SV=1 6 438 2.0E-57
sp|C4ZQ57|PNCB_ECOBW Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pncB PE=3 SV=1 6 438 2.0E-57
sp|Q8FJ98|PNCB_ECOL6 Nicotinate phosphoribosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pncB PE=3 SV=2 6 439 2.0E-57
sp|B7UN17|PNCB_ECO27 Nicotinate phosphoribosyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pncB PE=3 SV=1 6 439 2.0E-57
sp|B1LJT2|PNCB_ECOSM Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pncB PE=3 SV=1 6 439 2.0E-57
sp|B7NM43|PNCB_ECO7I Nicotinate phosphoribosyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pncB PE=3 SV=1 6 439 2.0E-57
sp|B7N398|PNCB_ECOLU Nicotinate phosphoribosyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pncB PE=3 SV=1 6 439 2.0E-57
sp|Q3Z3I9|PNCB_SHISS Nicotinate phosphoribosyltransferase OS=Shigella sonnei (strain Ss046) GN=pncB PE=3 SV=1 6 438 3.0E-57
sp|Q83LN3|PNCB_SHIFL Nicotinate phosphoribosyltransferase OS=Shigella flexneri GN=pncB PE=3 SV=4 6 438 3.0E-57
sp|Q31YR6|PNCB_SHIBS Nicotinate phosphoribosyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pncB PE=3 SV=1 6 438 3.0E-57
sp|B6I904|PNCB_ECOSE Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain SE11) GN=pncB PE=3 SV=1 6 438 3.0E-57
sp|A7ZYN4|PNCB_ECOHS Nicotinate phosphoribosyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=pncB PE=3 SV=1 6 438 3.0E-57
sp|B7M860|PNCB_ECO8A Nicotinate phosphoribosyltransferase OS=Escherichia coli O8 (strain IAI1) GN=pncB PE=3 SV=1 6 438 3.0E-57
sp|B7LE31|PNCB_ECO55 Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=pncB PE=3 SV=1 6 438 3.0E-57
sp|A7ZK22|PNCB_ECO24 Nicotinate phosphoribosyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pncB PE=3 SV=1 6 438 3.0E-57
sp|B2TUE4|PNCB_SHIB3 Nicotinate phosphoribosyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pncB PE=3 SV=1 6 439 5.0E-57
sp|A1W8S8|PNCB_ACISJ Nicotinate phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=pncB PE=3 SV=1 13 448 9.0E-57
sp|B9MHC7|PNCB_ACIET Nicotinate phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=pncB PE=3 SV=1 13 448 9.0E-57
sp|Q7N621|PNCB_PHOLL Nicotinate phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pncB PE=3 SV=1 13 437 1.0E-56
sp|B5YT65|PNCB_ECO5E Nicotinate phosphoribosyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pncB PE=3 SV=1 6 439 2.0E-56
sp|Q8XDE8|PNCB_ECO57 Nicotinate phosphoribosyltransferase OS=Escherichia coli O157:H7 GN=pncB PE=3 SV=3 6 439 2.0E-56
sp|A4XS60|PNCB_PSEMY Nicotinate phosphoribosyltransferase OS=Pseudomonas mendocina (strain ymp) GN=pncB PE=3 SV=1 13 431 2.0E-56
sp|Q32E52|PNCB_SHIDS Nicotinate phosphoribosyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pncB PE=3 SV=1 6 439 5.0E-56
sp|B0RVE9|PNCB_XANCB Nicotinate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pncB PE=3 SV=1 13 453 1.0E-55
sp|Q3BPD5|PNCB_XANC5 Nicotinate phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pncB PE=3 SV=1 13 426 2.0E-55
sp|Q8PGU5|PNCB_XANAC Nicotinate phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pncB PE=3 SV=1 13 426 2.0E-55
sp|C6DFB8|PNCB_PECCP Nicotinate phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pncB PE=3 SV=1 6 425 4.0E-55
sp|A1JMP2|PNCB_YERE8 Nicotinate phosphoribosyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pncB PE=3 SV=1 13 425 7.0E-55
sp|Q6D454|PNCB_PECAS Nicotinate phosphoribosyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pncB PE=3 SV=1 6 425 7.0E-55
sp|Q8PCP3|PNCB_XANCP Nicotinate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pncB PE=3 SV=1 13 453 9.0E-55
sp|Q4UQS8|PNCB_XANC8 Nicotinate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pncB PE=3 SV=1 13 453 9.0E-55
sp|Q3KIW4|PNCB_PSEPF Nicotinate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pncB PE=3 SV=1 13 425 1.0E-54
sp|Q66CG6|PNCB_YERPS Nicotinate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pncB PE=3 SV=1 6 441 1.0E-54
sp|Q8ZG93|PNCB_YERPE Nicotinate phosphoribosyltransferase OS=Yersinia pestis GN=pncB PE=1 SV=1 6 441 1.0E-54
sp|A7FJU4|PNCB_YERP3 Nicotinate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pncB PE=3 SV=1 6 441 1.0E-54
sp|Q9HUP4|PNCB1_PSEAE Nicotinate phosphoribosyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pncB1 PE=3 SV=1 13 431 2.0E-54
sp|B4TRW6|PNCB_SALSV Nicotinate phosphoribosyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=pncB PE=3 SV=1 6 439 3.0E-54
sp|B5BBM4|PNCB_SALPK Nicotinate phosphoribosyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=pncB PE=3 SV=1 6 439 3.0E-54
sp|A9N6Y6|PNCB_SALPB Nicotinate phosphoribosyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pncB PE=3 SV=1 6 439 3.0E-54
sp|Q5PGD8|PNCB_SALPA Nicotinate phosphoribosyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pncB PE=3 SV=1 6 439 3.0E-54
sp|B4T172|PNCB_SALNS Nicotinate phosphoribosyltransferase OS=Salmonella newport (strain SL254) GN=pncB PE=3 SV=1 6 439 3.0E-54
sp|B4TDS5|PNCB_SALHS Nicotinate phosphoribosyltransferase OS=Salmonella heidelberg (strain SL476) GN=pncB PE=3 SV=1 6 439 3.0E-54
sp|Q8Z7Y9|PNCB_SALTI Nicotinate phosphoribosyltransferase OS=Salmonella typhi GN=pncB PE=3 SV=3 6 439 5.0E-54
sp|Q57QZ3|PNCB_SALCH Nicotinate phosphoribosyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pncB PE=3 SV=2 6 439 5.0E-54
sp|B2VC92|PNCB_ERWT9 Nicotinate phosphoribosyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pncB PE=3 SV=1 13 439 6.0E-54
sp|C0PXX2|PNCB_SALPC Nicotinate phosphoribosyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=pncB PE=3 SV=1 6 439 7.0E-54
sp|B5R8M1|PNCB_SALG2 Nicotinate phosphoribosyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pncB PE=3 SV=1 6 439 7.0E-54
sp|B5QZD8|PNCB_SALEP Nicotinate phosphoribosyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=pncB PE=3 SV=1 6 439 7.0E-54
sp|B5FQ81|PNCB_SALDC Nicotinate phosphoribosyltransferase OS=Salmonella dublin (strain CT_02021853) GN=pncB PE=3 SV=1 6 439 7.0E-54
sp|B5F1U0|PNCB_SALA4 Nicotinate phosphoribosyltransferase OS=Salmonella agona (strain SL483) GN=pncB PE=3 SV=1 6 439 8.0E-54
sp|A8AIE5|PNCB_CITK8 Nicotinate phosphoribosyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pncB PE=3 SV=1 6 439 1.0E-53
sp|A4W8V0|PNCB_ENT38 Nicotinate phosphoribosyltransferase OS=Enterobacter sp. (strain 638) GN=pncB PE=3 SV=1 6 439 1.0E-53
sp|P22253|PNCB_SALTY Nicotinate phosphoribosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pncB PE=1 SV=2 6 439 1.0E-53
sp|Q9HW26|PNCB2_PSEAE Nicotinate phosphoribosyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pncB2 PE=1 SV=1 13 425 2.0E-53
sp|Q0K8J9|PNCB_CUPNH Nicotinate phosphoribosyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pncB PE=3 SV=1 13 429 2.0E-53
sp|Q87JE4|PNCB_VIBPA Nicotinate phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pncB PE=3 SV=1 13 421 3.0E-53
sp|Q87VL5|PNCB_PSESM Nicotinate phosphoribosyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pncB PE=3 SV=1 13 425 4.0E-53
sp|B7LNU8|PNCB_ESCF3 Nicotinate phosphoribosyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pncB PE=3 SV=1 6 439 4.0E-53
sp|A9MHU8|PNCB_SALAR Nicotinate phosphoribosyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pncB PE=3 SV=1 6 439 4.0E-53
sp|B1YVJ0|PNCB_BURA4 Nicotinate phosphoribosyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=pncB PE=3 SV=1 13 429 4.0E-53
sp|Q0BH38|PNCB_BURCM Nicotinate phosphoribosyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pncB PE=3 SV=1 13 429 4.0E-53
sp|C3LUC2|PNCB_VIBCM Nicotinate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pncB PE=3 SV=1 7 421 2.0E-52
sp|Q9KN67|PNCB_VIBCH Nicotinate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pncB PE=1 SV=1 7 421 2.0E-52
sp|A5F1F1|PNCB_VIBC3 Nicotinate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pncB PE=3 SV=1 7 421 2.0E-52
sp|Q48NY1|PNCB_PSE14 Nicotinate phosphoribosyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pncB PE=3 SV=1 13 425 3.0E-52
sp|A7N4I5|PNCB_VIBCB Nicotinate phosphoribosyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pncB PE=3 SV=1 13 421 3.0E-52
sp|A0K5S6|PNCB_BURCH Nicotinate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=pncB PE=3 SV=1 13 429 3.0E-52
sp|Q1BXX4|PNCB_BURCA Nicotinate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=pncB PE=3 SV=1 13 429 3.0E-52
sp|B1JY80|PNCB_BURCC Nicotinate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=pncB PE=3 SV=1 13 449 4.0E-52
sp|Q8Y0L2|PNCB_RALSO Nicotinate phosphoribosyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=pncB PE=3 SV=2 13 429 6.0E-52
sp|Q128P8|PNCB_POLSJ Nicotinate phosphoribosyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pncB PE=3 SV=1 13 450 6.0E-52
sp|Q4ZYV7|PNCB_PSEU2 Nicotinate phosphoribosyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pncB PE=3 SV=1 13 425 6.0E-52
sp|Q9JTM8|PNCB_NEIMA Nicotinate phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pncB PE=3 SV=2 13 430 1.0E-51
sp|Q9JYM9|PNCB_NEIMB Nicotinate phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pncB PE=3 SV=1 13 430 3.0E-51
sp|B4RL23|PNCB_NEIG2 Nicotinate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pncB PE=3 SV=1 13 430 5.0E-51
sp|Q5F836|PNCB_NEIG1 Nicotinate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pncB PE=3 SV=2 13 430 5.0E-51
sp|Q8K9I6|PNCB_BUCAP Nicotinate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pncB PE=3 SV=1 13 425 6.0E-51
sp|Q63S63|PNCB_BURPS Nicotinate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=pncB PE=3 SV=1 13 429 6.0E-51
sp|Q62LW1|PNCB_BURMA Nicotinate phosphoribosyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=pncB PE=3 SV=1 13 429 6.0E-51
sp|A4JCM8|PNCB_BURVG Nicotinate phosphoribosyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pncB PE=3 SV=1 13 429 1.0E-50
sp|A3MA25|PNCB_ACIBT Nicotinate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pncB PE=3 SV=2 13 444 2.0E-50
sp|B2I1P1|PNCB_ACIBC Nicotinate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=pncB PE=3 SV=1 13 444 2.0E-50
sp|A9M0T9|PNCB_NEIM0 Nicotinate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pncB PE=3 SV=1 13 430 2.0E-50
sp|B2U8V2|PNCB_RALPJ Nicotinate phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=pncB PE=3 SV=1 13 429 4.0E-50
sp|Q87EC4|PNCB_XYLFT Nicotinate phosphoribosyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pncB PE=3 SV=1 13 429 9.0E-50
sp|A7MEW8|PNCB_CROS8 Nicotinate phosphoribosyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pncB PE=3 SV=1 6 439 2.0E-49
sp|Q9PED1|PNCB_XYLFA Nicotinate phosphoribosyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=pncB PE=3 SV=1 13 429 3.0E-49
sp|Q6F6W1|PNCB_ACIAD Nicotinate phosphoribosyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pncB PE=3 SV=1 13 446 4.0E-49
sp|A9IIC5|PNCB_BORPD Nicotinate phosphoribosyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pncB PE=3 SV=1 13 429 4.0E-48
sp|Q2NU84|PNCB_SODGM Nicotinate phosphoribosyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pncB PE=3 SV=1 13 438 4.0E-48
sp|Q8DA38|PNCB_VIBVU Nicotinate phosphoribosyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=pncB PE=3 SV=1 13 421 1.0E-47
sp|B8D7P8|PNCB_BUCAT Nicotinate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pncB PE=3 SV=1 13 425 1.0E-47
sp|P57442|PNCB_BUCAI Nicotinate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pncB PE=3 SV=1 13 425 1.0E-47
sp|B8D9E6|PNCB_BUCA5 Nicotinate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pncB PE=3 SV=1 13 425 1.0E-47
sp|C5BD56|PNCB_EDWI9 Nicotinate phosphoribosyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=pncB PE=3 SV=1 13 426 3.0E-47
sp|Q7MK41|PNCB_VIBVY Nicotinate phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=pncB PE=3 SV=1 13 421 3.0E-47
sp|A8GCJ6|PNCB_SERP5 Nicotinate phosphoribosyltransferase OS=Serratia proteamaculans (strain 568) GN=pncB PE=3 SV=1 13 439 4.0E-47
sp|Q7W5G3|PNCB_BORPA Nicotinate phosphoribosyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pncB PE=3 SV=1 13 429 5.0E-47
sp|Q7WCZ8|PNCB_BORBR Nicotinate phosphoribosyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pncB PE=3 SV=1 13 429 5.0E-47
sp|Q7VTF7|PNCB_BORPE Nicotinate phosphoribosyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pncB PE=3 SV=1 13 429 1.0E-46
sp|Q7NSK2|PNCB_CHRVO Nicotinate phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pncB PE=3 SV=1 13 431 2.0E-45
sp|A5W9Q6|PNCB_PSEP1 Nicotinate phosphoribosyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pncB PE=3 SV=1 13 431 1.0E-44
sp|A4YK54|PNCB_BRASO Nicotinate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=pncB PE=3 SV=1 13 441 2.0E-44
sp|B9JYR4|PNCB_AGRVS Nicotinate phosphoribosyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pncB PE=3 SV=1 13 445 3.0E-44
sp|Q6LRA6|PNCB_PHOPR Nicotinate phosphoribosyltransferase OS=Photobacterium profundum GN=pncB PE=3 SV=1 13 425 4.0E-44
sp|C3MFW1|PNCB_RHISN Nicotinate phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=pncB PE=3 SV=1 13 441 5.0E-44
sp|Q88DF7|PNCB_PSEPK Nicotinate phosphoribosyltransferase OS=Pseudomonas putida (strain KT2440) GN=pncB PE=3 SV=2 13 425 5.0E-44
sp|Q92S49|PNCB_RHIME Nicotinate phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=pncB PE=3 SV=1 13 441 1.0E-43
sp|B9J6S5|PNCB_AGRRK Nicotinate phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pncB PE=3 SV=1 13 445 1.0E-43
sp|Q8UIS9|PNCB_AGRFC Nicotinate phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pncB PE=1 SV=2 13 441 3.0E-43
sp|B0KKX3|PNCB_PSEPG Nicotinate phosphoribosyltransferase OS=Pseudomonas putida (strain GB-1) GN=pncB PE=3 SV=1 13 431 6.0E-43
sp|B5ZWU4|PNCB_RHILW Nicotinate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pncB PE=3 SV=1 13 445 7.0E-43
sp|A6U5X9|PNCB_SINMW Nicotinate phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=pncB PE=3 SV=1 13 441 9.0E-43
sp|Q98D24|PNCB_RHILO Nicotinate phosphoribosyltransferase OS=Rhizobium loti (strain MAFF303099) GN=pncB PE=3 SV=1 13 445 9.0E-43
sp|A5E8V7|PNCB_BRASB Nicotinate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pncB PE=3 SV=1 13 441 2.0E-42
sp|Q6G5H6|PNCB_BARHE Nicotinate phosphoribosyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pncB PE=3 SV=1 13 445 2.0E-42
sp|Q2KDT0|PNCB_RHIEC Nicotinate phosphoribosyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pncB PE=3 SV=1 13 445 3.0E-42
sp|Q6G0X7|PNCB_BARQU Nicotinate phosphoribosyltransferase OS=Bartonella quintana (strain Toulouse) GN=pncB PE=3 SV=1 13 435 4.0E-42
sp|B3PXL5|PNCB_RHIE6 Nicotinate phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=pncB PE=3 SV=1 13 445 7.0E-42
sp|A1SVJ9|PNCB_PSYIN Nicotinate phosphoribosyltransferase OS=Psychromonas ingrahamii (strain 37) GN=pncB PE=3 SV=1 13 444 7.0E-42
sp|A6WV52|PNCB_OCHA4 Nicotinate phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pncB PE=3 SV=1 13 445 4.0E-41
sp|Q8G340|PNCB_BRUSU Nicotinate phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=pncB PE=3 SV=1 13 445 5.0E-40
sp|B0CIM5|PNCB_BRUSI Nicotinate phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pncB PE=3 SV=1 13 445 5.0E-40
sp|C0RGH3|PNCB_BRUMB Nicotinate phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pncB PE=3 SV=1 13 445 5.0E-40
sp|Q57FQ9|PNCB_BRUAB Nicotinate phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=pncB PE=3 SV=1 13 445 5.0E-40
sp|Q2YNV6|PNCB_BRUA2 Nicotinate phosphoribosyltransferase OS=Brucella abortus (strain 2308) GN=pncB PE=3 SV=1 13 445 5.0E-40
sp|B2S8A9|PNCB_BRUA1 Nicotinate phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=pncB PE=3 SV=1 13 445 5.0E-40
sp|A9ILN1|PNCB_BART1 Nicotinate phosphoribosyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pncB PE=3 SV=1 13 445 6.0E-40
sp|A9M757|PNCB_BRUC2 Nicotinate phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pncB PE=3 SV=1 13 445 7.0E-40
sp|A1UUA2|PNCB_BARBK Nicotinate phosphoribosyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pncB PE=3 SV=1 13 435 2.0E-39
sp|Q11HJ2|PNCB_CHESB Nicotinate phosphoribosyltransferase OS=Chelativorans sp. (strain BNC1) GN=pncB PE=3 SV=1 15 445 3.0E-39
sp|Q1QI14|PNCB_NITHX Nicotinate phosphoribosyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pncB PE=3 SV=1 13 445 3.0E-39
sp|Q8YEP2|PNCB_BRUME Nicotinate phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pncB PE=3 SV=1 13 445 9.0E-39
sp|A4G168|PNCB_HERAR Nicotinate phosphoribosyltransferase OS=Herminiimonas arsenicoxydans GN=pncB PE=3 SV=1 13 426 4.0E-38
sp|Q89SS3|PNCB_BRADU Nicotinate phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pncB PE=3 SV=1 13 445 5.0E-37
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8702 0.4091 0.1351 0.0754 0.1446 0.237 0.0911 0.1406 0.051 0.0071

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3885
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5363
Ophiocordyceps australis map64 (Brazil) OphauB2|7849
Ophiocordyceps camponoti-floridani Ophcf2|02386
Ophiocordyceps camponoti-rufipedis Ophun1|831
Ophiocordyceps kimflemingae Ophio5|1953 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7715

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1953
MDLDSSSPSLEGVASLLDTDLYKLTMQCAVFRFYKDVPVTYAFTNRTPEKRLSRAAFKWLDGQVKKLGDLSLSDD
EHNFLLSQCNYFTPDYLEYLREFRLRPCEEVSVTFMPVGPDTGSDSDIGDIDISIQGTWSGTILYEIPLLALVSE
AYFRFMDTDWNYDGQEEQAYAKGMQLLEAGCLTSEFGTRRRRDYHTQALVVRGLIRASGEAAARGLPGKLVGTSN
VHLAMRFGLFPVGTVAHEWFMGTAAIIDNYQKATEEALRHWISCFGSSLTIALTDTFGTPEFLKAFSLPIRPVDG
GVAPDVFRKPDGTIKTYAELFDGVRQDSGDPAEYTKRMRSYYDGQGVKDKKKIVFSDSLNIERCFEYKRISDEHG
FQATFGVGTFLSNDFVRLSTGAKSTPLNIVIKLSSAAGRPAIKISDTLGKNTGDKEVVERVKRELGYVEREWEEG
DESARWGKEEPARG
Coding >Ophio5|1953
ATGGACTTAGACAGCTCATCGCCCTCTCTCGAGGGGGTGGCATCGCTTCTCGACACCGACTTGTACAAGTTGACG
ATGCAATGTGCCGTCTTCAGGTTCTACAAAGACGTGCCCGTCACTTACGCCTTCACCAATCGGACTCCCGAGAAG
AGGCTCTCCCGCGCCGCCTTTAAATGGCTTGACGGGCAAGTAAAGAAACTTGGCGACCTTTCCCTCTCCGATGAC
GAACACAACTTCCTACTGTCGCAATGCAACTACTTCACCCCCGACTACCTCGAATATCTGCGAGAGTTCCGGTTG
CGGCCGTGCGAGGAGGTTTCGGTGACGTTTATGCCTGTTGGCCCCGACACCGGCTCTGACTCGGACATCGGAGAT
ATCGACATCAGCATCCAGGGAACCTGGTCTGGCACAATCCTCTACGAGATCCCACTGCTCGCGCTCGTATCCGAG
GCCTACTTTCGCTTCATGGACACGGACTGGAACTATGACGGCCAGGAGGAACAGGCCTACGCCAAGGGCATGCAG
CTTTTGGAAGCGGGCTGCCTCACGTCCGAGTTTGGCACACGCAGAAGACGCGACTATCACACCCAGGCTCTTGTG
GTGCGCGGACTTATCAGGGCATCCGGGGAAGCCGCTGCAAGGGGATTGCCCGGAAAATTGGTCGGCACCAGCAAC
GTGCACTTGGCCATGCGATTCGGCCTCTTTCCTGTTGGGACAGTGGCTCACGAGTGGTTTATGGGCACGGCCGCC
ATCATCGACAACTACCAAAAGGCCACGGAAGAAGCCCTGCGGCACTGGATTAGTTGCTTCGGCTCCAGCCTTACC
ATCGCCTTGACGGATACCTTTGGCACGCCCGAGTTTCTCAAGGCCTTTAGCCTGCCGATCCGACCGGTCGACGGC
GGTGTGGCGCCCGACGTGTTCCGCAAACCCGACGGCACCATCAAAACCTATGCCGAGCTCTTTGACGGGGTGAGG
CAGGACTCCGGCGATCCCGCGGAGTACACGAAAAGGATGCGGTCCTACTATGATGGGCAGGGTGTCAAGGACAAG
AAGAAAATCGTCTTCTCTGACTCGCTCAACATTGAACGCTGCTTCGAGTACAAGCGCATATCGGACGAGCACGGC
TTCCAGGCTACCTTTGGCGTTGGCACCTTTCTGTCAAATGACTTTGTCCGTCTCTCAACCGGGGCCAAGTCAACG
CCGCTGAATATTGTCATCAAGCTCAGTTCGGCTGCAGGCCGTCCGGCTATCAAGATCAGCGATACTCTGGGAAAG
AACACGGGAGACAAAGAGGTGGTAGAAAGAGTCAAGCGCGAGCTCGGCTACGTCGAGCGCGAGTGGGAGGAGGGC
GACGAAAGCGCGCGATGGGGCAAGGAAGAGCCGGCCAGAGGC
Transcript >Ophio5|1953
ATGGACTTAGACAGCTCATCGCCCTCTCTCGAGGGGGTGGCATCGCTTCTCGACACCGACTTGTACAAGTTGACG
ATGCAATGTGCCGTCTTCAGGTTCTACAAAGACGTGCCCGTCACTTACGCCTTCACCAATCGGACTCCCGAGAAG
AGGCTCTCCCGCGCCGCCTTTAAATGGCTTGACGGGCAAGTAAAGAAACTTGGCGACCTTTCCCTCTCCGATGAC
GAACACAACTTCCTACTGTCGCAATGCAACTACTTCACCCCCGACTACCTCGAATATCTGCGAGAGTTCCGGTTG
CGGCCGTGCGAGGAGGTTTCGGTGACGTTTATGCCTGTTGGCCCCGACACCGGCTCTGACTCGGACATCGGAGAT
ATCGACATCAGCATCCAGGGAACCTGGTCTGGCACAATCCTCTACGAGATCCCACTGCTCGCGCTCGTATCCGAG
GCCTACTTTCGCTTCATGGACACGGACTGGAACTATGACGGCCAGGAGGAACAGGCCTACGCCAAGGGCATGCAG
CTTTTGGAAGCGGGCTGCCTCACGTCCGAGTTTGGCACACGCAGAAGACGCGACTATCACACCCAGGCTCTTGTG
GTGCGCGGACTTATCAGGGCATCCGGGGAAGCCGCTGCAAGGGGATTGCCCGGAAAATTGGTCGGCACCAGCAAC
GTGCACTTGGCCATGCGATTCGGCCTCTTTCCTGTTGGGACAGTGGCTCACGAGTGGTTTATGGGCACGGCCGCC
ATCATCGACAACTACCAAAAGGCCACGGAAGAAGCCCTGCGGCACTGGATTAGTTGCTTCGGCTCCAGCCTTACC
ATCGCCTTGACGGATACCTTTGGCACGCCCGAGTTTCTCAAGGCCTTTAGCCTGCCGATCCGACCGGTCGACGGC
GGTGTGGCGCCCGACGTGTTCCGCAAACCCGACGGCACCATCAAAACCTATGCCGAGCTCTTTGACGGGGTGAGG
CAGGACTCCGGCGATCCCGCGGAGTACACGAAAAGGATGCGGTCCTACTATGATGGGCAGGGTGTCAAGGACAAG
AAGAAAATCGTCTTCTCTGACTCGCTCAACATTGAACGCTGCTTCGAGTACAAGCGCATATCGGACGAGCACGGC
TTCCAGGCTACCTTTGGCGTTGGCACCTTTCTGTCAAATGACTTTGTCCGTCTCTCAACCGGGGCCAAGTCAACG
CCGCTGAATATTGTCATCAAGCTCAGTTCGGCTGCAGGCCGTCCGGCTATCAAGATCAGCGATACTCTGGGAAAG
AACACGGGAGACAAAGAGGTGGTAGAAAGAGTCAAGCGCGAGCTCGGCTACGTCGAGCGCGAGTGGGAGGAGGGC
GACGAAAGCGCGCGATGGGGCAAGGAAGAGCCGGCCAGAGGCTAG
Gene >Ophio5|1953
ATGGACTTAGACAGCTCATCGCCCTCTCTCGAGGGGGTGGCATCGCTTCTCGACACCGACTTGTACAAGTTGACG
ATGCAATGTGCCGTCTTCAGGTTCTACAAAGACGTGCCCGTCACTTACGCCTTCACCAATCGGACTCCCGAGAAG
AGGCTCTCCCGCGCCGCCTTTAAATGGCTTGACGGGCAAGTAAAGAGTAAGATGATGGCGTCTTGGTCACCCGGG
TCTGCGTGGCGGCAGCTCACGTATGCTCTTAGAACTTGGCGACCTTTCCCTCTCCGATGACGAACACAACTTCCT
ACTGTCGCAATGCAACTACTTCACCCCCGACTACCTCGAATATCTGCGAGAGTTCCGGTTGCGGCCGTGCGAGGA
GGTTTCGGTGACGTTTATGCCTGTTGGCCCCGACACCGGCTCTGACTCGGACATCGGAGATATCGACATCAGCAT
CCAGGGAACCTGGTCTGGCACAATCCTCTACGAGATCCCACTGCTCGCGCTCGTATCCGAGGCCTACTTTCGCTT
CATGGACACGGACTGGAACTATGACGGCCAGGAGGAACAGGCCTACGCCAAGGGCATGCAGCTTTTGGAAGCGGG
CTGCCTCACGTCCGAGTTTGGCACACGCAGAAGACGCGACTATCACACCCAGGCTCTTGTGGTGCGCGGACTTAT
CAGGGCATCCGGGGAAGCCGCTGCAAGGGGATTGCCCGGAAAATTGGTCGGCACCAGCAACGTGCACTTGGCCAT
GCGATTCGGCCTCTTTCCTGTTGGGACAGTGGCTCACGAGTGGTTTATGGGCACGGCCGCCATCATCGACAACTA
CCAAAAGGCCACGGAAGAAGCCCTGCGGCACTGGATTAGTTGCTTCGGCTCCAGCCTTACCATCGCCTTGACGGA
TACCTTTGGCACGCCCGAGTTTCTCAAGGCCTTTAGCCTGCCGATCCGACCGGTCGACGGCGGTGTGGCGCCCGA
CGTGTTCCGCAAACCCGACGGCACCATCAAAACCTATGCCGAGCTCTTTGACGGGGTGAGGCAGGACTCCGGCGA
TCCCGCGGAGTACACGAAAAGGATGCGGTCCTACTATGATGGGCAGGGTGTCAAGGACAAGAAGAAAATCGTCTT
CTCTGACTCGCTCAACATTGAACGCTGCTTCGAGTACAAGCGCATATCGGACGAGCACGGCTTCCAGGCTACCTT
TGGCGTTGGCACCTTTCTGTCAAATGACTTTGTCCGTCTCTCAACCGGGGCCAAGTCAACGCCGCTGAATATTGT
CATCAAGCTCAGTTCGGCTGCAGGCCGTCCGGCTATCAAGATCAGGTAAGTGCAGAGATGACAGTTCAAGAGACC
GGCGGCTTGCTGACGAGTGACAGCGATACTCTGGGAAAGAACACGGGAGACAAAGAGGTGGTAGAAAGAGTCAAG
CGCGAGCTCGGCTACGTCGAGCGCGAGTGGGAGGAGGGCGACGAAAGCGCGCGATGGGGCAAGGAAGAGCCGGCC
AGAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail