Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1943
Gene name
Locationscaffold_176:13578..14985
Strand-
Gene length (bp)1407
Transcript length (bp)1221
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08313 SCA7 SCA7, zinc-binding domain 9.2E-31 203 269

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94397|SGF73_SCHPO SAGA-associated factor 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgf73 PE=3 SV=1 88 360 5.0E-41
sp|P53165|SGF73_YEAST SAGA-associated factor 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGF73 PE=1 SV=1 150 276 5.0E-18
sp|O15265|ATX7_HUMAN Ataxin-7 OS=Homo sapiens GN=ATXN7 PE=1 SV=1 217 299 1.0E-07
sp|P0DH68|Y3132_SELML SCA7 domain-containing protein SELMODRAFT_431321 OS=Selaginella moellendorffii GN=SELMODRAFT_431321 PE=3 SV=1 218 277 1.0E-07
sp|P0DH66|Y3925_SELML SCA7 domain-containing protein SELMODRAFT_439258 OS=Selaginella moellendorffii GN=SELMODRAFT_439258 PE=2 SV=1 218 275 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94397|SGF73_SCHPO SAGA-associated factor 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgf73 PE=3 SV=1 88 360 5.0E-41
sp|P53165|SGF73_YEAST SAGA-associated factor 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGF73 PE=1 SV=1 150 276 5.0E-18
sp|O15265|ATX7_HUMAN Ataxin-7 OS=Homo sapiens GN=ATXN7 PE=1 SV=1 217 299 1.0E-07
sp|P0DH68|Y3132_SELML SCA7 domain-containing protein SELMODRAFT_431321 OS=Selaginella moellendorffii GN=SELMODRAFT_431321 PE=3 SV=1 218 277 1.0E-07
sp|P0DH66|Y3925_SELML SCA7 domain-containing protein SELMODRAFT_439258 OS=Selaginella moellendorffii GN=SELMODRAFT_439258 PE=2 SV=1 218 275 3.0E-07
sp|Q9ULK2|AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens GN=ATXN7L1 PE=1 SV=3 217 274 5.0E-07
sp|Q8R4I1|ATX7_MOUSE Ataxin-7 OS=Mus musculus GN=Atxn7 PE=1 SV=2 217 272 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1943
MAPESDHTIKVASKKDSKLGAIKLKKPPPKYSKPGNWREGAVVEDDKKKKAGSSPSLSATSPGPVVNQLQDTARE
TFATGRPLEDSPDLQQCKHCKKSILKTAARAHISQCLRLKKEKAQRKKEAREARERAKEAAREEEARKADEENGN
AKGDDDSDDEDKHNKTNLAGKKAPGKKPEDDKKGKKRKAEGDVEKAPKVKKKKDEPKAKVPKPRGPVDVERQCGV
ILANGQPCARSLTCKSHSMGAKRAVAGRSLPYDMLLAAYQKKNQAKQQKAALDANAPVEDEDEANIGPVDSDEET
TAVMGALAHWNPQPLVSQPVFNPIKRQYHLARLHEQLQLATNGGRTNIFQVNGYGARMVPDAGLPESEDAPGEPD
LASMAAPRSASFGVIGASAAPQRRPSVTSRG
Coding >Ophio5|1943
ATGGCTCCTGAATCGGACCATACCATCAAGGTCGCCTCCAAGAAGGACTCCAAGTTGGGCGCCATCAAGCTCAAG
AAACCGCCGCCCAAGTATAGCAAGCCCGGAAACTGGAGGGAGGGTGCTGTCGTCGAAGACGACAAGAAGAAGAAG
GCTGGAAGCTCCCCTTCCCTTTCGGCCACTTCGCCCGGCCCGGTCGTCAACCAGCTCCAAGACACGGCCCGCGAG
ACCTTCGCCACGGGGCGCCCCTTAGAGGACAGCCCAGATCTGCAGCAGTGTAAGCACTGCAAGAAGAGCATATTA
AAGACGGCCGCCAGGGCACACATTTCTCAGTGTCTCAGGCTAAAGAAGGAAAAGGCTCAGCGCAAGAAGGAGGCT
CGCGAGGCACGAGAGAGAGCAAAGGAGGCCGCCCGAGAGGAGGAGGCCCGCAAGGCAGACGAAGAGAACGGCAAC
GCCAAGGGCGATGACGACAGCGACGACGAGGACAAGCACAACAAGACAAACTTGGCCGGCAAGAAAGCGCCTGGA
AAGAAGCCCGAAGACGACAAGAAGGGCAAGAAGCGGAAAGCTGAGGGCGATGTCGAGAAAGCCCCCAAGGTTAAG
AAGAAAAAGGACGAGCCCAAGGCCAAGGTGCCCAAGCCGCGAGGTCCCGTCGACGTCGAACGGCAGTGCGGCGTC
ATATTGGCCAACGGCCAACCCTGCGCCCGATCCCTGACCTGCAAGAGCCACTCCATGGGTGCCAAGCGTGCCGTG
GCCGGCAGGTCGCTCCCCTACGACATGCTCCTGGCGGCCTATCAGAAGAAAAACCAGGCCAAGCAGCAGAAGGCC
GCCCTCGATGCCAACGCGCCCGTCGAGGACGAAGACGAAGCAAATATCGGACCCGTCGATTCCGACGAGGAGACG
ACGGCCGTCATGGGCGCGCTGGCCCACTGGAACCCGCAACCACTTGTCTCTCAGCCCGTCTTCAACCCGATCAAG
CGCCAGTATCACCTCGCCAGACTGCACGAGCAGCTGCAGTTGGCCACCAACGGCGGCCGGACCAACATCTTCCAG
GTCAACGGCTACGGAGCGCGCATGGTGCCGGACGCCGGCTTGCCCGAGAGCGAGGACGCGCCCGGTGAGCCCGAT
CTCGCCAGCATGGCTGCGCCGCGCTCGGCGAGCTTTGGCGTCATAGGCGCTTCGGCTGCACCGCAACGCAGGCCG
TCAGTGACGAGTCGCGGC
Transcript >Ophio5|1943
ATGGCTCCTGAATCGGACCATACCATCAAGGTCGCCTCCAAGAAGGACTCCAAGTTGGGCGCCATCAAGCTCAAG
AAACCGCCGCCCAAGTATAGCAAGCCCGGAAACTGGAGGGAGGGTGCTGTCGTCGAAGACGACAAGAAGAAGAAG
GCTGGAAGCTCCCCTTCCCTTTCGGCCACTTCGCCCGGCCCGGTCGTCAACCAGCTCCAAGACACGGCCCGCGAG
ACCTTCGCCACGGGGCGCCCCTTAGAGGACAGCCCAGATCTGCAGCAGTGTAAGCACTGCAAGAAGAGCATATTA
AAGACGGCCGCCAGGGCACACATTTCTCAGTGTCTCAGGCTAAAGAAGGAAAAGGCTCAGCGCAAGAAGGAGGCT
CGCGAGGCACGAGAGAGAGCAAAGGAGGCCGCCCGAGAGGAGGAGGCCCGCAAGGCAGACGAAGAGAACGGCAAC
GCCAAGGGCGATGACGACAGCGACGACGAGGACAAGCACAACAAGACAAACTTGGCCGGCAAGAAAGCGCCTGGA
AAGAAGCCCGAAGACGACAAGAAGGGCAAGAAGCGGAAAGCTGAGGGCGATGTCGAGAAAGCCCCCAAGGTTAAG
AAGAAAAAGGACGAGCCCAAGGCCAAGGTGCCCAAGCCGCGAGGTCCCGTCGACGTCGAACGGCAGTGCGGCGTC
ATATTGGCCAACGGCCAACCCTGCGCCCGATCCCTGACCTGCAAGAGCCACTCCATGGGTGCCAAGCGTGCCGTG
GCCGGCAGGTCGCTCCCCTACGACATGCTCCTGGCGGCCTATCAGAAGAAAAACCAGGCCAAGCAGCAGAAGGCC
GCCCTCGATGCCAACGCGCCCGTCGAGGACGAAGACGAAGCAAATATCGGACCCGTCGATTCCGACGAGGAGACG
ACGGCCGTCATGGGCGCGCTGGCCCACTGGAACCCGCAACCACTTGTCTCTCAGCCCGTCTTCAACCCGATCAAG
CGCCAGTATCACCTCGCCAGACTGCACGAGCAGCTGCAGTTGGCCACCAACGGCGGCCGGACCAACATCTTCCAG
GTCAACGGCTACGGAGCGCGCATGGTGCCGGACGCCGGCTTGCCCGAGAGCGAGGACGCGCCCGGTGAGCCCGAT
CTCGCCAGCATGGCTGCGCCGCGCTCGGCGAGCTTTGGCGTCATAGGCGCTTCGGCTGCACCGCAACGCAGGCCG
TCAGTGACGAGTCGCGGCTGA
Gene >Ophio5|1943
ATGGCTCCTGAATCGGACCATACCATCAAGGTCGCCTCCAAGAAGGACTCCAAGTTGGGCGCCATCAAGCTCAAG
AAACCGCCGCCCAAGTATAGCAAGCCCGGAAACTGGAGGGAGGGTGCTGTCGTCGAAGGTTCGTCTCCCAACCTG
GGCACCACTGCCAGTCGGCTAACGGTCATACCCTCATCGTCAGACGACAAGAAGAAGAAGGCTGGAAGCTCCCCT
TCCCTTTCGGCCACTTCGCCCGGCCCGGTCGTCAACCAGCTCCAAGACACGGCCCGCGAGACCTTCGCCACGGGG
CGCCCCTTAGAGGACAGCCCAGATCTGCAGCAGTGTAAGCACTGCAAGAAGAGCATATTAAAGACGGCCGCCAGG
GCACACATTTCTCAGTGTCTCAGGCTAAAGAAGGAAAAGGCTCAGCGCAAGAAGGAGGCTCGCGAGGCACGAGAG
AGAGCAAAGGAGGCCGCCCGAGAGGAGGAGGCCCGCAAGGCAGACGAAGAGAACGGCAACGCCAAGGGCGATGAC
GACAGCGACGACGAGGACAAGCACAACAAGACAAACTTGGCCGGCAAGAAAGCGCCTGGAAAGAAGCCCGAAGAC
GACAAGAAGGGCAAGAAGCGGAAAGCTGAGGGCGATGTCGAGAAAGCCCCCAAGGTTAAGAAGAAAAAGGACGAG
CCCAAGGCCAAGGTGCCCAAGCCGCGAGGTATGCGTGCTGCAGCACTGAATCCATCCCGTCCTTGTGCTGACGTC
TTCGGTCGCCGCGCCAGGTCCCGTCGACGTCGAACGGCAGTGCGGCGTCATATTGGCCAACGGCCAACCCTGCGC
CCGATCCCTGACCTGCAAGAGCCACTCCATGGGTGCCAAGCGTGCCGTGGCCGGCAGGTCGCTCCCCTACGACAT
GCTCCTGGCGGCCTATCAGAAGAAAAACCAGGCCAAGCAGCAGAGTAAGAAGCTACATGACGTGCCCGAGCCGGC
GACCGATGGCTGACTGTGAGTTATACTACAGAGGCCGCCCTCGATGCCAACGCGCCCGTCGAGGACGAAGACGAA
GCAAATATCGGACCCGTCGATTCCGACGAGGAGACGACGGCCGTCATGGGCGCGCTGGCCCACTGGAACCCGCAA
CCACTTGTCTCTCAGCCCGTCTTCAACCCGATCAAGCGCCAGTATCACCTCGCCAGACTGCACGAGCAGCTGCAG
TTGGCCACCAACGGCGGCCGGACCAACATCTTCCAGGTCAACGGCTACGGAGCGCGCATGGTGCCGGACGCCGGC
TTGCCCGAGAGCGAGGACGCGCCCGGTGAGCCCGATCTCGCCAGCATGGCTGCGCCGCGCTCGGCGAGCTTTGGC
GTCATAGGCGCTTCGGCTGCACCGCAACGCAGGCCGTCAGTGACGAGTCGCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail