Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|194
Gene name
Locationscaffold_103:40230..41298
Strand+
Gene length (bp)1068
Transcript length (bp)948
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10173 Mit_KHE1 Mitochondrial K+-H+ exchange-related 8.2E-56 2 177

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13942|YEPC_SCHPO Uncharacterized protein C23H3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H3.12c PE=4 SV=1 1 198 3.0E-17
sp|P48569|YD183_YEAST Uncharacterized protein YDL183C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL183C PE=4 SV=1 1 252 1.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 135 157 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|194
MRIFLLPVSTRRSLLYAQRLDPADGSSRRSLVDRGAAWATSKWAQWEKKPTGWQRRVVDYGNHALRRIPFEEWGL
KSVPPLSVRRREEEQAGKIRVELVFPGGAFSPHEARALVLRLATERLSLHRQRFLWSLAAMPLTLPFALVPIIPN
LPFFYLVYRAWSHWRAIAGGRHVQWLLDTKLLHSAPSAKLSQLYTSDDCGQSSFRKQEADEETMLLTQKQVRGFC
DALAVPALEVELERAVWQVHKALEKSRSAPETQPNQASAGNQASKAQSSPARERDKNIAYDIERLEVKDRGASRT
LRNRHPHTLREFNDC
Coding >Ophio5|194
ATGCGCATTTTTCTCCTGCCCGTGTCAACACGACGTAGCCTTCTTTACGCTCAGCGGCTCGATCCCGCAGACGGC
TCGTCCCGCCGTAGCCTCGTCGACCGCGGCGCCGCCTGGGCCACAAGCAAGTGGGCGCAGTGGGAAAAGAAGCCG
ACGGGCTGGCAGCGGCGTGTCGTCGACTACGGAAATCATGCCCTGAGGCGGATTCCCTTTGAGGAATGGGGTCTC
AAGTCTGTGCCGCCGTTATCGGTTCGAAGAAGAGAGGAGGAGCAGGCTGGCAAAATTCGCGTCGAGCTCGTCTTT
CCTGGTGGTGCCTTTTCTCCCCATGAGGCTCGTGCCTTGGTTCTGAGGCTTGCTACCGAGAGGCTTAGTCTGCAT
CGTCAGCGCTTCTTATGGAGCCTTGCTGCTATGCCTCTCACTCTACCATTTGCTCTCGTCCCCATCATCCCCAAC
CTACCCTTCTTCTACCTCGTCTACCGCGCCTGGTCACACTGGCGCGCCATTGCCGGCGGCCGCCACGTACAATGG
CTCCTCGATACCAAGCTCCTCCACTCGGCGCCCTCAGCTAAGCTGAGCCAACTCTACACCAGCGACGACTGCGGC
CAGTCCTCGTTCCGGAAACAAGAAGCGGACGAAGAAACGATGCTCTTGACGCAGAAGCAGGTTCGCGGCTTCTGC
GACGCCCTGGCCGTGCCCGCCCTCGAAGTGGAGCTCGAGCGAGCCGTCTGGCAAGTTCACAAAGCGTTGGAGAAG
AGCCGGTCCGCGCCCGAGACGCAGCCGAATCAGGCATCGGCCGGCAACCAGGCCTCAAAGGCACAGAGCTCGCCT
GCGCGGGAACGAGATAAGAATATCGCCTATGACATCGAGAGGCTCGAGGTCAAGGACCGTGGCGCCAGCCGGACG
CTGCGCAATCGACACCCTCACACACTCAGAGAGTTCAATGATTGC
Transcript >Ophio5|194
ATGCGCATTTTTCTCCTGCCCGTGTCAACACGACGTAGCCTTCTTTACGCTCAGCGGCTCGATCCCGCAGACGGC
TCGTCCCGCCGTAGCCTCGTCGACCGCGGCGCCGCCTGGGCCACAAGCAAGTGGGCGCAGTGGGAAAAGAAGCCG
ACGGGCTGGCAGCGGCGTGTCGTCGACTACGGAAATCATGCCCTGAGGCGGATTCCCTTTGAGGAATGGGGTCTC
AAGTCTGTGCCGCCGTTATCGGTTCGAAGAAGAGAGGAGGAGCAGGCTGGCAAAATTCGCGTCGAGCTCGTCTTT
CCTGGTGGTGCCTTTTCTCCCCATGAGGCTCGTGCCTTGGTTCTGAGGCTTGCTACCGAGAGGCTTAGTCTGCAT
CGTCAGCGCTTCTTATGGAGCCTTGCTGCTATGCCTCTCACTCTACCATTTGCTCTCGTCCCCATCATCCCCAAC
CTACCCTTCTTCTACCTCGTCTACCGCGCCTGGTCACACTGGCGCGCCATTGCCGGCGGCCGCCACGTACAATGG
CTCCTCGATACCAAGCTCCTCCACTCGGCGCCCTCAGCTAAGCTGAGCCAACTCTACACCAGCGACGACTGCGGC
CAGTCCTCGTTCCGGAAACAAGAAGCGGACGAAGAAACGATGCTCTTGACGCAGAAGCAGGTTCGCGGCTTCTGC
GACGCCCTGGCCGTGCCCGCCCTCGAAGTGGAGCTCGAGCGAGCCGTCTGGCAAGTTCACAAAGCGTTGGAGAAG
AGCCGGTCCGCGCCCGAGACGCAGCCGAATCAGGCATCGGCCGGCAACCAGGCCTCAAAGGCACAGAGCTCGCCT
GCGCGGGAACGAGATAAGAATATCGCCTATGACATCGAGAGGCTCGAGGTCAAGGACCGTGGCGCCAGCCGGACG
CTGCGCAATCGACACCCTCACACACTCAGAGAGTTCAATGATTGCTAG
Gene >Ophio5|194
ATGCGCATTTTTCTCCTGCCCGTGTCAACACGACGTAGCCTTCTTTACGCTCAGCGGCTCGATCCCGCAGACGGC
TCGTCCCGCCGTAGCCTCGTCGACCGCGGCGCCGCCTGGGCCACAAGCAAGTGGGCGCAGTGGGAAAAGAAGCCG
ACGGGCTGGCAGCGGCGTGTCGTCGACTACGGAAATCATGCCCTGAGGCGGATTCCCTTTGAGGAATGGGGTCTC
AAGTCTGTGCCGCCGTTATCGGTTCGAAGAAGAGAGGAGGAGCAGGCTGGCAAAATTCGCGTCGAGCTCGTCTTT
CCTGGTGGTGCCTTTTCTCCCCATGAGGCTCGTGCCTTGGTTCTGAGGCTTGCTACCGAGAGGCTTAGTCTGCAT
CGTCAGCGCTTCTTATGGAGCCTTGCTGCTATGCCTCTCACTCTACCATTTGCTCTCGTCCCCATGTACGGAACC
CGTTTCCCAAAACAGTCTCATCCAGCTTGCATGCTAACTAGAATGGTCCCATAGCATCCCCAACCTACCCTTCTT
CTACCTCGTCTACCGCGCCTGGTCACACTGGCGCGCCATTGCCGGCGGCCGCCACGTACAATGGCTCCTCGATAC
CAAGCTCCTCCACTCGGCGCCCTCAGCTAAGCTGAGCCAACTCTACACCAGCGACGACTGCGGCCAGTCCTCGTT
CCGGAAACAAGAAGCGGACGAAGAAACGATGCTCTTGACGCAGAAGCAGGTTCGCGGCTTCTGCGACGCCCTGGC
CGTGCCCGCCCTCGAAGTGGAGCTCGAGCGAGCCGTCTGGCAAGTTCACAAAGCGTTGGAGAAGAGCCGGTCCGC
GCCCGAGACGCAGCCGAATCAGGCATCGGCCGGCAACCAGGCCTCAAAGGCACAGAGCTCGCCTGCGCGGGAACG
AGATAAGAATAGTTAACCAGCATGCTCAATGGCTTCCTCTCATGCGTGTATATATAATTGCACATAGTCGCCTAT
GACATCGAGAGGCTCGAGGTCAAGGACCGTGGCGCCAGCCGGACGCTGCGCAATCGACACCCTCACACACTCAGA
GAGTTCAATGATTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail