Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1922
Gene name
Locationscaffold_174:34028..34540
Strand-
Gene length (bp)512
Transcript length (bp)459
Coding sequence length (bp)456
Protein length (aa) 152

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.61 0.0 7.49
CcL In ants, during behavior modification 0.90 0.0 2.30
CcD In ants, recently dead 0.62 0.0 2.01

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.142930 no
SC16a CcD 0.110129 no
CcL CcD 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1922
MLWRSAVAPLFLTVGLLLPSGSKALPTGGSEVSRRWYMPIPTGSGGSPPRGAAGQSSGSNTGTGTIGGLGNPATG
GAGTGSHHAPAVGLSVGGNRPALAGGSVAPGPPPTRQHIGEEMHHIFPNRPIRRQPLGFAPSPFWRPWETPTRSG
RL
Coding >Ophio5|1922
ATGCTCTGGCGTTCAGCTGTTGCTCCTTTGTTCCTGACCGTCGGCCTGCTCTTGCCGTCTGGTTCCAAGGCTCTG
CCCACCGGGGGTAGCGAAGTCTCGCGGCGGTGGTATATGCCGATCCCCACCGGCTCCGGCGGCTCCCCTCCGCGC
GGCGCCGCGGGGCAAAGCTCGGGCTCCAACACCGGCACCGGCACCATTGGTGGGCTGGGTAATCCGGCCACCGGT
GGCGCAGGCACGGGCAGCCACCATGCTCCCGCCGTCGGTCTGTCCGTCGGCGGCAATAGGCCAGCGTTGGCGGGG
GGAAGCGTCGCCCCAGGTCCCCCCCCAACACGACAGCATATAGGCGAAGAAATGCACCACATCTTTCCGAACCGA
CCAATCCGACGACAGCCTCTGGGTTTTGCACCCTCGCCTTTCTGGCGGCCTTGGGAGACTCCAACGAGATCGGGC
CGACTC
Transcript >Ophio5|1922
ATGCTCTGGCGTTCAGCTGTTGCTCCTTTGTTCCTGACCGTCGGCCTGCTCTTGCCGTCTGGTTCCAAGGCTCTG
CCCACCGGGGGTAGCGAAGTCTCGCGGCGGTGGTATATGCCGATCCCCACCGGCTCCGGCGGCTCCCCTCCGCGC
GGCGCCGCGGGGCAAAGCTCGGGCTCCAACACCGGCACCGGCACCATTGGTGGGCTGGGTAATCCGGCCACCGGT
GGCGCAGGCACGGGCAGCCACCATGCTCCCGCCGTCGGTCTGTCCGTCGGCGGCAATAGGCCAGCGTTGGCGGGG
GGAAGCGTCGCCCCAGGTCCCCCCCCAACACGACAGCATATAGGCGAAGAAATGCACCACATCTTTCCGAACCGA
CCAATCCGACGACAGCCTCTGGGTTTTGCACCCTCGCCTTTCTGGCGGCCTTGGGAGACTCCAACGAGATCGGGC
CGACTCTAA
Gene >Ophio5|1922
ATGCTCTGGCGTTCAGCTGTTGCTCCTTTGTTCCTGACCGTCGGCCTGCTCTTGCCGTCTGGTTCCAAGGCTCTG
CCCACCGGGGTAAGTCGGGGCAAGCAAACAAATTTCAAGCGGGCTGCTAACATATAGCAAAGGGTAGCGAAGTCT
CGCGGCGGTGGTATATGCCGATCCCCACCGGCTCCGGCGGCTCCCCTCCGCGCGGCGCCGCGGGGCAAAGCTCGG
GCTCCAACACCGGCACCGGCACCATTGGTGGGCTGGGTAATCCGGCCACCGGTGGCGCAGGCACGGGCAGCCACC
ATGCTCCCGCCGTCGGTCTGTCCGTCGGCGGCAATAGGCCAGCGTTGGCGGGGGGAAGCGTCGCCCCAGGTCCCC
CCCCAACACGACAGCATATAGGCGAAGAAATGCACCACATCTTTCCGAACCGACCAATCCGACGACAGCCTCTGG
GTTTTGCACCCTCGCCTTTCTGGCGGCCTTGGGAGACTCCAACGAGATCGGGCCGACTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail