Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1910
Gene name
Locationscaffold_173:32371..34549
Strand-
Gene length (bp)2178
Transcript length (bp)2103
Coding sequence length (bp)2100
Protein length (aa) 700

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7029 0.387 0.1441 0.2077 0.1902 0.047 0.2011 0.2188 0.1613 0.1053

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup754
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1567
Ophiocordyceps australis map64 (Brazil) OphauB2|1332
Ophiocordyceps camponoti-floridani Ophcf2|00459
Ophiocordyceps camponoti-rufipedis Ophun1|1090
Ophiocordyceps kimflemingae Ophio5|1910 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2313
Ophiocordyceps subramaniannii Hirsu2|2314

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1910
MLEGRGGTGRYYSAVNPPIHSPLPSPPLLLHAPSSAHALSPGTRPTTVLQRGAAVCFPHLYATVQQQHSSSSRGP
PGWSPFVAAAANPPPPFAISPIPLLPPSIIRPTSVCASSPSFPPAPVAGPRGMSSLKLKPLLLPQLVQERRKLDG
QCPPTSPDAVDISHAFNSSESDAESPVTPVVSPRGLSQRLSSSSLSPELPTPETPSSPTAQLFDKRFLPDVLEDP
MERFEEDAISFSSASSEHFGLYSCLCDTPCQHRSSSEGLSPDDMVGDFDLDYDMGFLSDGDSAAATDPRQPLKKR
VADGSSPFAGLTSRIGSRLPAIKRWRSNRRANAVSSPLTDLSLENVFSRGPSSRSSSLSASNQQTTPERLSDMPP
ASSMPSSSTISYFDSSENLSGSSLVDMTPEDQSNLERDRSMATTPLLPPLLTDPLGKPPQESPLQSPTVAPTPAA
AAAAPPPPPPLPAPAGLSPPPLSSRPSLTSLRQVSSSTTAELPLPLPAILQEHDEWSDRLGHANFTITPLPYELE
TLSNETVSRFRDDWDAARVNYTKHLVRTGEHYGQTSKIYALTEAKWAETERRWKGFYDDMIRQSSRSAPDSGNPS
RSHSRGRGRGRSSSSVPVIGRLHSSDDVLAGLDWRRMDDCLPSAVPRMLESLDAQGKFPCRGDEDIVGPMQRAAV
MARARSEDAKGHFWRSIADKVGFRK
Coding >Ophio5|1910
ATGCTGGAGGGACGAGGCGGAACAGGGCGGTACTACAGCGCAGTAAACCCCCCCATCCACTCCCCCCTCCCCTCT
CCGCCCCTTCTGCTGCACGCCCCCTCCAGTGCCCACGCCCTCTCCCCGGGCACCCGCCCAACCACCGTCCTCCAG
CGAGGCGCTGCTGTTTGTTTCCCGCACCTCTACGCTACTGTGCAGCAGCAGCACAGCAGCAGCAGCAGAGGGCCC
CCGGGCTGGTCGCCTTTTGTAGCTGCTGCCGCCAACCCCCCCCCCCCCTTCGCGATATCCCCAATCCCCCTTCTA
CCTCCCAGCATCATCCGCCCAACCTCGGTCTGCGCTTCATCTCCTTCGTTTCCGCCGGCTCCAGTTGCCGGGCCG
CGAGGCATGTCGTCGCTGAAGCTCAAACCGCTGCTGCTGCCGCAGCTCGTCCAAGAGCGCCGCAAACTCGACGGC
CAGTGCCCGCCGACGAGTCCCGATGCCGTCGACATCTCGCACGCTTTCAATTCCTCCGAGTCGGATGCCGAGTCA
CCCGTGACGCCCGTCGTGTCGCCTCGAGGTCTTTCGCAGCGCCTGTCGAGCTCTTCGTTGTCGCCTGAACTGCCG
ACGCCGGAAACGCCCTCGTCGCCGACAGCCCAGCTCTTCGACAAGCGTTTCCTGCCCGACGTCCTGGAGGATCCG
ATGGAGCGCTTCGAAGAGGATGCCATCTCGTTCTCGTCGGCCTCGTCGGAGCACTTTGGCCTTTACAGCTGTCTG
TGCGACACACCGTGTCAGCATCGCAGCAGCTCCGAGGGCCTGTCTCCTGACGACATGGTCGGCGACTTCGACTTG
GACTACGACATGGGATTCCTGAGCGACGGCGACTCAGCGGCAGCGACCGACCCGCGTCAACCGCTCAAAAAGCGC
GTTGCTGACGGCAGCTCGCCCTTTGCCGGCCTGACGTCGCGCATCGGTTCGCGGCTCCCTGCCATCAAGCGCTGG
AGGTCAAACCGGCGAGCCAACGCCGTCTCGTCGCCACTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGG
CCGTCCAGCCGCTCCTCGTCATTATCGGCTTCGAACCAACAGACGACGCCAGAGCGCCTCTCGGACATGCCGCCA
GCCTCTAGCATGCCATCCAGCTCCACGATATCCTACTTCGACAGCTCCGAAAACCTGAGTGGCTCGTCGCTCGTC
GACATGACGCCCGAGGATCAGTCCAACCTCGAGCGCGACCGCTCCATGGCCACGACGCCCCTGCTGCCCCCGCTC
CTCACCGATCCGCTGGGCAAGCCACCGCAGGAGTCGCCTCTCCAGTCGCCCACGGTGGCGCCAACGCCCGCCGCC
GCCGCCGCCGCGCCTCCTCCTCCTCCTCCGCTGCCTGCGCCCGCAGGCTTGTCACCACCGCCGCTCAGCAGTCGG
CCCTCGTTGACGTCGCTACGGCAGGTGTCGTCTTCCACGACGGCCGAGCTGCCCCTCCCGCTTCCCGCCATCCTG
CAGGAGCACGACGAGTGGTCGGATCGCCTGGGCCACGCCAATTTCACCATTACCCCCCTACCGTACGAGCTGGAG
ACGCTGTCAAACGAGACGGTTAGCCGGTTTCGCGACGACTGGGATGCGGCGCGCGTCAATTATACCAAGCACCTG
GTCCGCACTGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCCGAGACGGAG
CGGCGCTGGAAGGGCTTCTACGACGACATGATCCGGCAAAGCAGCCGCTCCGCCCCCGACTCGGGCAACCCCTCG
CGCAGCCATAGCCGGGGTCGCGGGCGTGGGCGCTCCAGCAGCTCCGTGCCCGTCATCGGCCGACTGCACTCGAGC
GACGACGTGCTCGCCGGTCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGGATGCTCGAG
TCGCTCGACGCCCAGGGTAAGTTTCCCTGCCGGGGCGACGAGGACATTGTTGGGCCCATGCAGCGGGCAGCCGTC
ATGGCTCGGGCTCGCAGTGAGGACGCCAAAGGCCACTTCTGGAGAAGCATTGCCGACAAGGTGGGATTCCGCAAG
Transcript >Ophio5|1910
ATGCTGGAGGGACGAGGCGGAACAGGGCGGTACTACAGCGCAGTAAACCCCCCCATCCACTCCCCCCTCCCCTCT
CCGCCCCTTCTGCTGCACGCCCCCTCCAGTGCCCACGCCCTCTCCCCGGGCACCCGCCCAACCACCGTCCTCCAG
CGAGGCGCTGCTGTTTGTTTCCCGCACCTCTACGCTACTGTGCAGCAGCAGCACAGCAGCAGCAGCAGAGGGCCC
CCGGGCTGGTCGCCTTTTGTAGCTGCTGCCGCCAACCCCCCCCCCCCCTTCGCGATATCCCCAATCCCCCTTCTA
CCTCCCAGCATCATCCGCCCAACCTCGGTCTGCGCTTCATCTCCTTCGTTTCCGCCGGCTCCAGTTGCCGGGCCG
CGAGGCATGTCGTCGCTGAAGCTCAAACCGCTGCTGCTGCCGCAGCTCGTCCAAGAGCGCCGCAAACTCGACGGC
CAGTGCCCGCCGACGAGTCCCGATGCCGTCGACATCTCGCACGCTTTCAATTCCTCCGAGTCGGATGCCGAGTCA
CCCGTGACGCCCGTCGTGTCGCCTCGAGGTCTTTCGCAGCGCCTGTCGAGCTCTTCGTTGTCGCCTGAACTGCCG
ACGCCGGAAACGCCCTCGTCGCCGACAGCCCAGCTCTTCGACAAGCGTTTCCTGCCCGACGTCCTGGAGGATCCG
ATGGAGCGCTTCGAAGAGGATGCCATCTCGTTCTCGTCGGCCTCGTCGGAGCACTTTGGCCTTTACAGCTGTCTG
TGCGACACACCGTGTCAGCATCGCAGCAGCTCCGAGGGCCTGTCTCCTGACGACATGGTCGGCGACTTCGACTTG
GACTACGACATGGGATTCCTGAGCGACGGCGACTCAGCGGCAGCGACCGACCCGCGTCAACCGCTCAAAAAGCGC
GTTGCTGACGGCAGCTCGCCCTTTGCCGGCCTGACGTCGCGCATCGGTTCGCGGCTCCCTGCCATCAAGCGCTGG
AGGTCAAACCGGCGAGCCAACGCCGTCTCGTCGCCACTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGG
CCGTCCAGCCGCTCCTCGTCATTATCGGCTTCGAACCAACAGACGACGCCAGAGCGCCTCTCGGACATGCCGCCA
GCCTCTAGCATGCCATCCAGCTCCACGATATCCTACTTCGACAGCTCCGAAAACCTGAGTGGCTCGTCGCTCGTC
GACATGACGCCCGAGGATCAGTCCAACCTCGAGCGCGACCGCTCCATGGCCACGACGCCCCTGCTGCCCCCGCTC
CTCACCGATCCGCTGGGCAAGCCACCGCAGGAGTCGCCTCTCCAGTCGCCCACGGTGGCGCCAACGCCCGCCGCC
GCCGCCGCCGCGCCTCCTCCTCCTCCTCCGCTGCCTGCGCCCGCAGGCTTGTCACCACCGCCGCTCAGCAGTCGG
CCCTCGTTGACGTCGCTACGGCAGGTGTCGTCTTCCACGACGGCCGAGCTGCCCCTCCCGCTTCCCGCCATCCTG
CAGGAGCACGACGAGTGGTCGGATCGCCTGGGCCACGCCAATTTCACCATTACCCCCCTACCGTACGAGCTGGAG
ACGCTGTCAAACGAGACGGTTAGCCGGTTTCGCGACGACTGGGATGCGGCGCGCGTCAATTATACCAAGCACCTG
GTCCGCACTGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCCGAGACGGAG
CGGCGCTGGAAGGGCTTCTACGACGACATGATCCGGCAAAGCAGCCGCTCCGCCCCCGACTCGGGCAACCCCTCG
CGCAGCCATAGCCGGGGTCGCGGGCGTGGGCGCTCCAGCAGCTCCGTGCCCGTCATCGGCCGACTGCACTCGAGC
GACGACGTGCTCGCCGGTCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGGATGCTCGAG
TCGCTCGACGCCCAGGGTAAGTTTCCCTGCCGGGGCGACGAGGACATTGTTGGGCCCATGCAGCGGGCAGCCGTC
ATGGCTCGGGCTCGCAGTGAGGACGCCAAAGGCCACTTCTGGAGAAGCATTGCCGACAAGGTGGGATTCCGCAAG
TGA
Gene >Ophio5|1910
ATGCTGGAGGGACGAGGCGGAACAGGGCGGTACTACAGCGCAGTAAACCCCCCCATCCACTCCCCCCTCCCCTCT
CCGCCCCTTCTGCTGCACGCCCCCTCCAGTGCCCACGCCCTCTCCCCGGGCACCCGCCCAACCACCGTCCTCCAG
CGAGGCGCTGCTGTTTGTTTCCCGCACCTCTACGCTACTGTGCAGCAGCAGCACAGCAGCAGCAGCAGAGGGCCC
CCGGGCTGGTCGCCTTTTGTAGCTGCTGCCGCCAACCCCCCCCCCCCCTTCGCGATATCCCCAATCCCCCTTCTA
CCTCCCAGCATCATCCGCCCAACCTCGGTCTGCGCTTCATCTCCTTCGTTTCCGCCGGCTCCAGTTGCCGGGCCG
CGAGGCATGTCGTCGCTGAAGCTCAAACCGCTGCTGCTGCCGCAGCTCGTCCAAGAGCGCCGCAAACTCGACGGC
CAGTGCCCGCCGACGAGTCCCGATGCCGTCGACATCTCGCACGCTTTCAATTCCTCCGAGTCGGATGCCGAGTCA
CCCGTGACGCCCGTCGTGTCGCCTCGAGGTCTTTCGCAGCGCCTGTCGAGCTCTTCGTTGTCGCCTGAACTGCCG
ACGCCGGAAACGCCCTCGTCGCCGACAGCCCAGCTCTTCGACAAGCGTTTCCTGCCCGACGTCCTGGAGGATCCG
ATGGAGCGCTTCGAAGAGGATGCCATCTCGTTCTCGTCGGCCTCGTCGGAGCACTTTGGCCTTTACAGCTGTCTG
TGTAAGTCGGCGATGGCCCTTTTTTTTTTTTTTTGGTATCGTCCAGCCGCTGACGGGAAGGAAAAAAAAAATTTA
GGCGACACACCGTGTCAGCATCGCAGCAGCTCCGAGGGCCTGTCTCCTGACGACATGGTCGGCGACTTCGACTTG
GACTACGACATGGGATTCCTGAGCGACGGCGACTCAGCGGCAGCGACCGACCCGCGTCAACCGCTCAAAAAGCGC
GTTGCTGACGGCAGCTCGCCCTTTGCCGGCCTGACGTCGCGCATCGGTTCGCGGCTCCCTGCCATCAAGCGCTGG
AGGTCAAACCGGCGAGCCAACGCCGTCTCGTCGCCACTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGG
CCGTCCAGCCGCTCCTCGTCATTATCGGCTTCGAACCAACAGACGACGCCAGAGCGCCTCTCGGACATGCCGCCA
GCCTCTAGCATGCCATCCAGCTCCACGATATCCTACTTCGACAGCTCCGAAAACCTGAGTGGCTCGTCGCTCGTC
GACATGACGCCCGAGGATCAGTCCAACCTCGAGCGCGACCGCTCCATGGCCACGACGCCCCTGCTGCCCCCGCTC
CTCACCGATCCGCTGGGCAAGCCACCGCAGGAGTCGCCTCTCCAGTCGCCCACGGTGGCGCCAACGCCCGCCGCC
GCCGCCGCCGCGCCTCCTCCTCCTCCTCCGCTGCCTGCGCCCGCAGGCTTGTCACCACCGCCGCTCAGCAGTCGG
CCCTCGTTGACGTCGCTACGGCAGGTGTCGTCTTCCACGACGGCCGAGCTGCCCCTCCCGCTTCCCGCCATCCTG
CAGGAGCACGACGAGTGGTCGGATCGCCTGGGCCACGCCAATTTCACCATTACCCCCCTACCGTACGAGCTGGAG
ACGCTGTCAAACGAGACGGTTAGCCGGTTTCGCGACGACTGGGATGCGGCGCGCGTCAATTATACCAAGCACCTG
GTCCGCACTGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCCGAGACGGAG
CGGCGCTGGAAGGGCTTCTACGACGACATGATCCGGCAAAGCAGCCGCTCCGCCCCCGACTCGGGCAACCCCTCG
CGCAGCCATAGCCGGGGTCGCGGGCGTGGGCGCTCCAGCAGCTCCGTGCCCGTCATCGGCCGACTGCACTCGAGC
GACGACGTGCTCGCCGGTCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGGATGCTCGAG
TCGCTCGACGCCCAGGGTAAGTTTCCCTGCCGGGGCGACGAGGACATTGTTGGGCCCATGCAGCGGGCAGCCGTC
ATGGCTCGGGCTCGCAGTGAGGACGCCAAAGGCCACTTCTGGAGAAGCATTGCCGACAAGGTGGGATTCCGCAAG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail