Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1892
Gene name
Locationscaffold_172:25073..25800
Strand-
Gene length (bp)727
Transcript length (bp)660
Coding sequence length (bp)657
Protein length (aa) 219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08229 SHR3_chaperone ER membrane protein SH3 9.4E-75 19 218

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02774|SHR3_YEAST Secretory component protein SHR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHR3 PE=1 SV=2 16 217 5.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 75 97 22
3 104 126 22
4 164 182 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 124.97 67.38 182.57
CcL In ants, during behavior modification 195.76 106.04 285.48
CcD In ants, recently dead 158.72 85.70 231.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.044536 yes
SC16a CcD 0.331913 no
CcL CcD 0.392394 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1892
MAPYVDYSKTTKSKGYRGSGSFATFMIIGPTCFFLGILFASFPYDFPLLWTKEPASDNYYDQLEAHLKFLHRSPP
LIGRMLNIVVSVGFLGLFIKLFRPSEANFLFDGASLILYTIGVAVYISNIVKGLRTLSSGLWDSDEFKNSREGRF
EGEFILGREDSLKVLAASNTILALVLIGVLVLQAGQWYAEKRDSDDEDNMDKSSGGKAATATAATKKKQ
Coding >Ophio5|1892
ATGGCGCCCTACGTCGACTATTCGAAGACGACCAAATCAAAGGGCTACCGCGGCTCCGGCTCGTTCGCGACCTTT
ATGATTATCGGACCGACGTGCTTCTTCCTCGGAATTCTTTTCGCCTCGTTTCCCTACGACTTTCCCCTGCTCTGG
ACCAAGGAGCCGGCCAGCGACAACTACTACGACCAGCTTGAGGCACACCTCAAGTTCCTGCACCGGTCTCCGCCG
CTCATCGGGCGGATGCTCAACATCGTCGTCAGCGTAGGCTTCCTGGGCCTCTTCATCAAGCTTTTCCGCCCCAGC
GAGGCCAATTTTCTGTTCGACGGCGCGTCTTTGATACTCTACACCATTGGCGTGGCCGTCTACATCTCCAACATT
GTCAAGGGCCTGCGCACCCTCAGCTCGGGTCTCTGGGACAGCGACGAATTCAAGAATAGCCGCGAGGGCCGGTTC
GAGGGCGAATTCATCCTGGGGCGCGAGGACAGTCTTAAGGTGCTGGCCGCGAGCAACACAATCCTGGCTCTGGTC
CTTATCGGCGTCCTCGTTCTTCAAGCCGGGCAATGGTACGCGGAGAAGAGGGATTCGGATGACGAGGATAACATG
GACAAGTCCTCCGGCGGCAAAGCGGCGACGGCGACGGCGGCGACGAAGAAGAAGCAG
Transcript >Ophio5|1892
ATGGCGCCCTACGTCGACTATTCGAAGACGACCAAATCAAAGGGCTACCGCGGCTCCGGCTCGTTCGCGACCTTT
ATGATTATCGGACCGACGTGCTTCTTCCTCGGAATTCTTTTCGCCTCGTTTCCCTACGACTTTCCCCTGCTCTGG
ACCAAGGAGCCGGCCAGCGACAACTACTACGACCAGCTTGAGGCACACCTCAAGTTCCTGCACCGGTCTCCGCCG
CTCATCGGGCGGATGCTCAACATCGTCGTCAGCGTAGGCTTCCTGGGCCTCTTCATCAAGCTTTTCCGCCCCAGC
GAGGCCAATTTTCTGTTCGACGGCGCGTCTTTGATACTCTACACCATTGGCGTGGCCGTCTACATCTCCAACATT
GTCAAGGGCCTGCGCACCCTCAGCTCGGGTCTCTGGGACAGCGACGAATTCAAGAATAGCCGCGAGGGCCGGTTC
GAGGGCGAATTCATCCTGGGGCGCGAGGACAGTCTTAAGGTGCTGGCCGCGAGCAACACAATCCTGGCTCTGGTC
CTTATCGGCGTCCTCGTTCTTCAAGCCGGGCAATGGTACGCGGAGAAGAGGGATTCGGATGACGAGGATAACATG
GACAAGTCCTCCGGCGGCAAAGCGGCGACGGCGACGGCGGCGACGAAGAAGAAGCAGTGA
Gene >Ophio5|1892
ATGGCGCCCTACGTCGACTATTCGAAGACGACCAAATCAAAGGGCTACCGCGGCTCCGGCTCGTTCGCGACCTTT
ATGATTATCGGACGTGCGTTTTACCTTCCCCATCCCCCCCCGCGTAAGGACTTCGTCGCCGACGACTTTTTTGTC
TATAGCGACGTGCTTCTTCCTCGGAATTCTTTTCGCCTCGTTTCCCTACGACTTTCCCCTGCTCTGGACCAAGGA
GCCGGCCAGCGACAACTACTACGACCAGCTTGAGGCACACCTCAAGTTCCTGCACCGGTCTCCGCCGCTCATCGG
GCGGATGCTCAACATCGTCGTCAGCGTAGGCTTCCTGGGCCTCTTCATCAAGCTTTTCCGCCCCAGCGAGGCCAA
TTTTCTGTTCGACGGCGCGTCTTTGATACTCTACACCATTGGCGTGGCCGTCTACATCTCCAACATTGTCAAGGG
CCTGCGCACCCTCAGCTCGGGTCTCTGGGACAGCGACGAATTCAAGAATAGCCGCGAGGGCCGGTTCGAGGGCGA
ATTCATCCTGGGGCGCGAGGACAGTCTTAAGGTGCTGGCCGCGAGCAACACAATCCTGGCTCTGGTCCTTATCGG
CGTCCTCGTTCTTCAAGCCGGGCAATGGTACGCGGAGAAGAGGGATTCGGATGACGAGGATAACATGGACAAGTC
CTCCGGCGGCAAAGCGGCGACGGCGACGGCGGCGACGAAGAAGAAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail