Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1890
Gene name
Locationscaffold_172:22209..22940
Strand+
Gene length (bp)731
Transcript length (bp)576
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03073 TspO_MBR TspO/MBR family 1.1E-45 22 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94327|TSPO_SCHPO Translocator protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.10 PE=3 SV=2 20 175 2.0E-22
sp|P30536|TSPOA_HUMAN Translocator protein OS=Homo sapiens GN=TSPO PE=1 SV=3 18 167 2.0E-18
sp|P16257|TSPO_RAT Translocator protein OS=Rattus norvegicus GN=Tspo PE=1 SV=1 18 167 5.0E-17
sp|O28797|TSPO_ARCFU Tryptophan-rich protein TspO OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tspO PE=3 SV=1 20 175 2.0E-16
sp|P50637|TSPO_MOUSE Translocator protein OS=Mus musculus GN=Tspo PE=1 SV=1 18 167 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94327|TSPO_SCHPO Translocator protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.10 PE=3 SV=2 20 175 2.0E-22
sp|P30536|TSPOA_HUMAN Translocator protein OS=Homo sapiens GN=TSPO PE=1 SV=3 18 167 2.0E-18
sp|P16257|TSPO_RAT Translocator protein OS=Rattus norvegicus GN=Tspo PE=1 SV=1 18 167 5.0E-17
sp|O28797|TSPO_ARCFU Tryptophan-rich protein TspO OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tspO PE=3 SV=1 20 175 2.0E-16
sp|P50637|TSPO_MOUSE Translocator protein OS=Mus musculus GN=Tspo PE=1 SV=1 18 167 2.0E-16
sp|P30535|TSPO_BOVIN Translocator protein OS=Bos taurus GN=TSPO PE=2 SV=1 18 190 3.0E-16
sp|Q8KBX2|TSPO_CHLTE Tryptophan-rich protein TspO OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=crtK-2 PE=1 SV=1 24 175 1.0E-14
sp|Q9GMC9|TSPO_SHEEP Translocator protein OS=Ovis aries GN=TSPO PE=1 SV=1 39 167 2.0E-14
sp|Q6UN27|TSPO_PIG Translocator protein OS=Sus scrofa GN=TSPO PE=2 SV=1 45 167 7.0E-14
sp|Q9RFC8|TSPO_RHOSH Tryptophan-rich sensory protein OS=Rhodobacter sphaeroides GN=tspO PE=1 SV=1 42 175 3.0E-12
sp|P17057|CRTK_RHOCB Protein CrtK OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtK PE=3 SV=1 45 180 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 58 80 22
3 100 119 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1890
MTTYMPSLTIPAAVLQHPAASVLLPVALGTAVGFGTRPADTQKTYLALKQPPLRPPPWVFGPVWTVLYGLMGYAS
YRVATIGLAPFASPETVRVTRQSLTIYTIQLGLNLVWMPLFFVAKRPVEATIDIVTLLGLNGYLAYAWHSVDHIA
GLCQLPYLGWLSFATYLCAGAGHLNDWDLSDKVTRVPDKKK
Coding >Ophio5|1890
ATGACGACCTACATGCCCAGCCTTACCATTCCGGCCGCCGTGCTTCAGCACCCGGCCGCCTCCGTCCTCCTTCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGTACCCGCCCTGCCGATACGCAAAAGACGTACCTGGCTCTTAAGCAG
CCGCCTCTGCGGCCACCGCCTTGGGTCTTTGGCCCCGTCTGGACGGTGCTCTACGGGCTTATGGGCTATGCCTCG
TACCGCGTCGCCACCATCGGCCTCGCACCCTTTGCGTCACCCGAGACCGTCCGCGTCACCAGACAAAGCCTGACA
ATCTACACCATCCAGCTCGGCCTCAACCTTGTGTGGATGCCCCTCTTCTTCGTCGCCAAGCGCCCCGTCGAGGCC
ACCATCGACATTGTCACTCTGCTCGGACTCAATGGCTACTTGGCCTACGCGTGGCACTCCGTCGACCACATCGCT
GGCCTGTGTCAGCTGCCTTACCTCGGCTGGCTGAGCTTCGCCACCTACTTGTGCGCTGGCGCGGGACACCTCAAC
GACTGGGACCTTTCGGACAAGGTTACTCGCGTGCCTGACAAGAAGAAG
Transcript >Ophio5|1890
ATGACGACCTACATGCCCAGCCTTACCATTCCGGCCGCCGTGCTTCAGCACCCGGCCGCCTCCGTCCTCCTTCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGTACCCGCCCTGCCGATACGCAAAAGACGTACCTGGCTCTTAAGCAG
CCGCCTCTGCGGCCACCGCCTTGGGTCTTTGGCCCCGTCTGGACGGTGCTCTACGGGCTTATGGGCTATGCCTCG
TACCGCGTCGCCACCATCGGCCTCGCACCCTTTGCGTCACCCGAGACCGTCCGCGTCACCAGACAAAGCCTGACA
ATCTACACCATCCAGCTCGGCCTCAACCTTGTGTGGATGCCCCTCTTCTTCGTCGCCAAGCGCCCCGTCGAGGCC
ACCATCGACATTGTCACTCTGCTCGGACTCAATGGCTACTTGGCCTACGCGTGGCACTCCGTCGACCACATCGCT
GGCCTGTGTCAGCTGCCTTACCTCGGCTGGCTGAGCTTCGCCACCTACTTGTGCGCTGGCGCGGGACACCTCAAC
GACTGGGACCTTTCGGACAAGGTTACTCGCGTGCCTGACAAGAAGAAGTAG
Gene >Ophio5|1890
ATGACGACCTACATGCCCAGCCTTACCATTCCGGCCGCCGTGCTTCAGCACCCGGCCGCCTCCGTCCTCCTTCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGTACCCGCCGTGAGCACAGCCGCCCGCCTCCCCGTCTCGACATGGAC
TGAATCGCCGGGCTTCTCGTCATCATCATCTTTTTTTTTTATCTCCTTTGCAGCTGCCGATACGCAAAAGACGTA
CCTGGCTCTTAAGCAGCCGCCTCTGCGGCCACCGCCTTGGGTCTTTGGCCCCGTCTGGACGGTGCTCTACGGGTA
GGTCGCTCCCGCAACGCTCTCCCCGGCTGAAACTCATCGTCATGTACCTGCGCCGCTCTAGGCTTATGGGCTATG
CCTCGTACCGCGTCGCCACCATCGGCCTCGCACCCTTTGCGTCACCCGAGACCGTCCGCGTCACCAGACAAAGCC
TGACAATCTACACCATCCAGCTCGGCCTCAACCTTGTGTGGATGCCCCTCTTCTTCGTCGCCAAGCGCCCCGTCG
AGGCCACCATCGACATTGTCACTCTGCTCGGACTCAATGGCTACTTGGCCTACGCGTGGCACTCCGTCGACCACA
TCGCTGGCCTGTGTCAGCTGCCTTACCTCGGCTGGCTGAGCTTCGCCACCTACTTGTGCGCTGGCGCGGGACACC
TCAACGACTGGGACCTTTCGGACAAGGTTACTCGCGTGCCTGACAAGAAGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail