Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1886
Gene name
Locationscaffold_172:12311..13937
Strand-
Gene length (bp)1626
Transcript length (bp)1407
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01070 FMN_dh FMN-dependent dehydrogenase 7.4E-105 112 452
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.5E-18 9 79
PF01645 Glu_synthase Conserved region in glutamate synthase 5.1E-06 375 413

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 3 456 3.0E-98
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 9 452 8.0E-95
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 6 458 3.0E-88
sp|Q9NYQ2|HAOX2_MOUSE Hydroxyacid oxidase 2 OS=Mus musculus GN=Hao2 PE=1 SV=1 101 456 3.0E-66
sp|O49506|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1 102 453 4.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 3 456 3.0E-98
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 9 452 8.0E-95
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 6 458 3.0E-88
sp|Q9NYQ2|HAOX2_MOUSE Hydroxyacid oxidase 2 OS=Mus musculus GN=Hao2 PE=1 SV=1 101 456 3.0E-66
sp|O49506|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1 102 453 4.0E-60
sp|Q8H3I4|GLO4_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. japonica GN=GLO4 PE=2 SV=2 103 446 7.0E-60
sp|Q07523|HAOX2_RAT Hydroxyacid oxidase 2 OS=Rattus norvegicus GN=Hao2 PE=1 SV=2 102 456 2.0E-59
sp|Q3ZBW2|HAOX2_BOVIN Hydroxyacid oxidase 2 OS=Bos taurus GN=HAO2 PE=2 SV=1 102 456 1.0E-58
sp|Q9NYQ3|HAOX2_HUMAN Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=1 SV=1 101 456 1.0E-58
sp|Q24JJ8|GLO3_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Arabidopsis thaliana GN=GLO3 PE=2 SV=1 99 446 2.0E-58
sp|B8B8K5|GLO4_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. indica GN=GLO4 PE=3 SV=2 103 446 2.0E-57
sp|Q9LJH5|GLO4_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Arabidopsis thaliana GN=GLO4 PE=2 SV=1 99 446 6.0E-57
sp|P05414|GOX_SPIOL Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1 102 446 2.0E-56
sp|Q9LRR9|GLO1_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Arabidopsis thaliana GN=GLO1 PE=1 SV=1 102 453 2.0E-56
sp|Q6YT73|GLO5_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. japonica GN=GLO5 PE=2 SV=1 99 446 4.0E-56
sp|B8B7C5|GLO5_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. indica GN=GLO5 PE=3 SV=1 99 446 4.0E-56
sp|Q9LRS0|GLO2_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Arabidopsis thaliana GN=GLO2 PE=1 SV=1 102 451 7.0E-56
sp|Q54E41|HAOX_DICDI Hydroxyacid oxidase OS=Dictyostelium discoideum GN=haox PE=3 SV=1 99 451 1.0E-55
sp|Q7FAS1|GLO3_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. japonica GN=GLO3 PE=2 SV=1 102 458 1.0E-55
sp|B8AUI3|GLO3_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. indica GN=GLO3 PE=3 SV=1 102 458 1.0E-55
sp|Q10CE4|GLO1_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. japonica GN=GLO1 PE=1 SV=1 99 446 5.0E-53
sp|B8AKX6|GLO1_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. indica GN=GLO1 PE=3 SV=1 99 446 5.0E-53
sp|Q9UJM8|HAOX1_HUMAN Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1 SV=1 99 451 4.0E-52
sp|Q9WU19|HAOX1_MOUSE Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=1 SV=1 99 451 2.0E-51
sp|Q7XPR4|GLO2_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Oryza sativa subsp. japonica GN=GLO2 PE=3 SV=3 99 458 4.0E-48
sp|Q01KC2|GLO2_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Oryza sativa subsp. indica GN=GLO2 PE=3 SV=2 99 458 4.0E-48
sp|P9WND5|LLDD_MYCTU Putative L-lactate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lldD PE=1 SV=1 99 456 3.0E-42
sp|P9WND4|LLDD_MYCTO Putative L-lactate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lldD PE=3 SV=1 99 456 3.0E-42
sp|O52792|HMO_AMYOR 4-hydroxymandelate oxidase OS=Amycolatopsis orientalis GN=hmo PE=1 SV=1 101 443 4.0E-37
sp|Q4ZY06|LLDD_PSEU2 L-lactate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lldD PE=3 SV=1 107 446 1.0E-32
sp|O33655|LA2M_STRIN Lactate 2-monooxygenase OS=Streptococcus iniae GN=lctO PE=3 SV=1 84 446 2.0E-32
sp|P20932|MDLB_PSEPU (S)-mandelate dehydrogenase OS=Pseudomonas putida GN=mdlB PE=1 SV=1 101 456 2.0E-32
sp|P21795|LA2M_MYCSM Lactate 2-monooxygenase OS=Mycobacterium smegmatis PE=1 SV=3 94 446 9.0E-32
sp|Q6DAY3|LLDD_PECAS L-lactate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lldD PE=3 SV=1 107 446 1.0E-31
sp|B4SMK1|LLDD_STRM5 L-lactate dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=lldD PE=3 SV=1 107 447 5.0E-30
sp|Q87G18|LLDD_VIBPA L-lactate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lldD PE=3 SV=1 107 446 5.0E-30
sp|Q1R0J2|LLDD_CHRSD L-lactate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lldD PE=3 SV=1 107 447 5.0E-30
sp|B2FIJ0|LLDD_STRMK L-lactate dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=lldD PE=3 SV=1 107 447 8.0E-30
sp|B0RLM2|LLDD_XANCB L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lldD PE=3 SV=1 107 459 3.0E-28
sp|C3K053|LLDD_PSEFS L-lactate dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=lldD PE=3 SV=2 107 446 4.0E-28
sp|B0KIT4|LLDD_PSEPG L-lactate dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=lldD PE=3 SV=1 107 446 4.0E-28
sp|Q8PE75|LLDD_XANCP L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lldD PE=3 SV=1 107 459 7.0E-28
sp|Q4V0H2|LLDD_XANC8 L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lldD PE=3 SV=1 107 459 7.0E-28
sp|C3LWP7|LLDD_VIBCM L-lactate dehydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lldD PE=3 SV=1 107 446 7.0E-28
sp|Q9KKW6|LLDD_VIBCH L-lactate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lldD PE=3 SV=1 107 446 7.0E-28
sp|Q3BZH2|LLDD_XANC5 L-lactate dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lldD PE=3 SV=1 107 465 1.0E-27
sp|B9K115|LLDD_AGRVS L-lactate dehydrogenase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=lldD PE=3 SV=1 107 448 1.0E-27
sp|Q8PR33|LLDD_XANAC L-lactate dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lldD PE=3 SV=1 107 465 1.0E-27
sp|A4XYG7|LLDD_PSEMY L-lactate dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=lldD PE=3 SV=1 107 455 2.0E-27
sp|B1JPU0|LLDD_YERPY L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|Q66C32|LLDD_YERPS L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|A4TKI4|LLDD_YERPP L-lactate dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|Q1CGZ1|LLDD_YERPN L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|A9R623|LLDD_YERPG L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|Q8ZFV8|LLDD_YERPE L-lactate dehydrogenase OS=Yersinia pestis GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|B2JZQ1|LLDD_YERPB L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|Q1C9P0|LLDD_YERPA L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|A7FJF0|LLDD_YERP3 L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lldD PE=3 SV=1 107 446 5.0E-27
sp|B1J244|LLDD_PSEPW L-lactate dehydrogenase OS=Pseudomonas putida (strain W619) GN=lldD PE=3 SV=1 107 446 1.0E-26
sp|B0BTC7|LLDD_ACTPJ L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lldD PE=3 SV=1 143 446 2.0E-26
sp|B3GZA5|LLDD_ACTP7 L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lldD PE=3 SV=1 143 446 2.0E-26
sp|A3N3E5|LLDD_ACTP2 L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lldD PE=3 SV=1 143 446 2.0E-26
sp|Q1IF69|LLDD_PSEE4 L-lactate dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=lldD PE=3 SV=1 107 446 3.0E-26
sp|Q5H6Z4|LLDD_XANOR L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lldD PE=3 SV=1 107 465 4.0E-26
sp|B2SUY3|LLDD_XANOP L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lldD PE=3 SV=1 107 465 4.0E-26
sp|Q2P9K0|LLDD_XANOM L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lldD PE=3 SV=1 107 465 4.0E-26
sp|Q88DT3|LLDD_PSEPK L-lactate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lldD PE=3 SV=1 107 446 5.0E-26
sp|A5W9B2|LLDD_PSEP1 L-lactate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lldD PE=3 SV=1 107 446 5.0E-26
sp|Q6WB83|LLDD_ALCFA L-lactate dehydrogenase OS=Alcaligenes faecalis GN=lldD PE=3 SV=1 107 451 5.0E-26
sp|A5UFG9|LLDD_HAEIG L-lactate dehydrogenase OS=Haemophilus influenzae (strain PittGG) GN=lldD PE=3 SV=1 107 451 1.0E-25
sp|A5UBE3|LLDD_HAEIE L-lactate dehydrogenase OS=Haemophilus influenzae (strain PittEE) GN=lldD PE=3 SV=1 107 451 1.0E-25
sp|P46454|LLDD_HAEIN L-lactate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lldD PE=3 SV=1 107 451 2.0E-25
sp|Q4QJK8|LLDD_HAEI8 L-lactate dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=lldD PE=3 SV=1 107 451 2.0E-25
sp|Q6G4R2|LLDD_BARHE L-lactate dehydrogenase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lldD PE=3 SV=1 107 446 3.0E-25
sp|A7IMB0|LLDD_XANP2 L-lactate dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lldD PE=3 SV=1 143 458 6.0E-25
sp|A6VCM8|LLDD_PSEA7 L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=lldD PE=3 SV=1 107 446 1.0E-24
sp|Q7VPI9|LLDD_HAEDU L-lactate dehydrogenase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lldD PE=3 SV=1 143 446 2.0E-24
sp|A8HTC9|LLDD_AZOC5 L-lactate dehydrogenase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lldD PE=3 SV=1 106 446 2.0E-24
sp|Q9HDX2|YKN3_SCHPO Uncharacterized lactate 2-monooxygenase PB1A11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A11.03 PE=3 SV=1 109 439 2.0E-24
sp|Q9HV37|LLDD_PSEAE L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lldD PE=3 SV=1 107 446 3.0E-24
sp|B7V1I3|LLDD_PSEA8 L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=lldD PE=3 SV=1 107 446 3.0E-24
sp|B1LK44|LLDD_ECOSM L-lactate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lldD PE=3 SV=1 132 446 5.0E-24
sp|A4W540|LLDD_ENT38 L-lactate dehydrogenase OS=Enterobacter sp. (strain 638) GN=lldD PE=3 SV=1 132 446 5.0E-24
sp|Q02FQ1|LLDD_PSEAB L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lldD PE=3 SV=1 107 446 5.0E-24
sp|Q31V17|LLDD_SHIBS L-lactate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=lldD PE=3 SV=1 132 446 5.0E-24
sp|B2U5C2|LLDD_SHIB3 L-lactate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|B7NER0|LLDD_ECOLU L-lactate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|P33232|LLDD_ECOLI L-lactate dehydrogenase OS=Escherichia coli (strain K12) GN=lldD PE=1 SV=1 132 446 6.0E-24
sp|B1IZI5|LLDD_ECOLC L-lactate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|A8A670|LLDD_ECOHS L-lactate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|B1X8M0|LLDD_ECODH L-lactate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|C4ZXJ7|LLDD_ECOBW L-lactate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|Q3YVX0|LLDD_SHISS L-lactate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|Q83PP7|LLDD_SHIFL L-lactate dehydrogenase OS=Shigella flexneri GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|Q0SYD1|LLDD_SHIF8 L-lactate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|B6I3I4|LLDD_ECOSE L-lactate dehydrogenase OS=Escherichia coli (strain SE11) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|B7M492|LLDD_ECO8A L-lactate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|B5YWA7|LLDD_ECO5E L-lactate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|Q8XDF7|LLDD_ECO57 L-lactate dehydrogenase OS=Escherichia coli O157:H7 GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|B7L725|LLDD_ECO55 L-lactate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|A7ZTF9|LLDD_ECO24 L-lactate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lldD PE=3 SV=1 132 446 6.0E-24
sp|B0V6L1|LLDD_ACIBY L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=lldD PE=3 SV=1 106 446 7.0E-24
sp|A3M0X0|LLDD_ACIBT L-lactate dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lldD PE=3 SV=2 106 446 7.0E-24
sp|B0VND0|LLDD_ACIBS L-lactate dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=lldD PE=3 SV=1 106 446 7.0E-24
sp|B2I061|LLDD_ACIBC L-lactate dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=lldD PE=3 SV=1 106 446 7.0E-24
sp|B7IBS4|LLDD_ACIB5 L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=lldD PE=3 SV=1 106 446 7.0E-24
sp|B7H2H0|LLDD_ACIB3 L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=lldD PE=3 SV=1 106 446 7.0E-24
sp|Q6FFS1|LLDD_ACIAD L-lactate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lldD PE=3 SV=1 106 446 1.0E-23
sp|A8ARJ1|LLDD_CITK8 L-lactate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lldD PE=3 SV=1 132 446 1.0E-23
sp|Q329P9|LLDD_SHIDS L-lactate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lldD PE=3 SV=1 132 446 1.0E-23
sp|Q1R4Z0|LLDD_ECOUT L-lactate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=lldD PE=3 SV=1 132 446 2.0E-23
sp|Q8FCB1|LLDD_ECOL6 L-lactate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lldD PE=3 SV=1 132 446 2.0E-23
sp|Q0TBK1|LLDD_ECOL5 L-lactate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lldD PE=3 SV=1 132 446 2.0E-23
sp|B7NPB4|LLDD_ECO7I L-lactate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lldD PE=3 SV=1 132 446 2.0E-23
sp|B7MFG9|LLDD_ECO45 L-lactate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lldD PE=3 SV=1 132 446 2.0E-23
sp|B7N251|LLDD_ECO81 L-lactate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=lldD PE=3 SV=1 132 446 3.0E-23
sp|B7LTL2|LLDD_ESCF3 L-lactate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=lldD PE=3 SV=1 132 446 3.0E-23
sp|B7ULG1|LLDD_ECO27 L-lactate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lldD PE=3 SV=1 143 446 3.0E-23
sp|A1AHE2|LLDD_ECOK1 L-lactate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=lldD PE=3 SV=1 132 446 4.0E-23
sp|B4T986|LLDD_SALHS L-lactate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=lldD PE=3 SV=1 132 446 2.0E-22
sp|B5BHX7|LLDD_SALPK L-lactate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=lldD PE=3 SV=1 132 446 2.0E-22
sp|Q5PLQ7|LLDD_SALPA L-lactate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lldD PE=3 SV=1 132 446 2.0E-22
sp|A6TFK0|LLDD_KLEP7 L-lactate dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lldD PE=3 SV=1 132 446 2.0E-22
sp|A7MNF6|LLDD_CROS8 L-lactate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lldD PE=3 SV=1 144 446 2.0E-22
sp|B5XMV0|LLDD_KLEP3 L-lactate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=lldD PE=3 SV=1 132 446 2.0E-22
sp|Q57ID8|LLDD_SALCH L-lactate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=lldD PE=3 SV=1 132 446 3.0E-22
sp|C0Q1T7|LLDD_SALPC L-lactate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=lldD PE=3 SV=1 132 446 4.0E-22
sp|A9MVJ5|LLDD_SALPB L-lactate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lldD PE=3 SV=1 132 446 4.0E-22
sp|Q8ZL61|LLDD_SALTY L-lactate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lldD PE=3 SV=1 132 446 5.0E-22
sp|B5FLH2|LLDD_SALDC L-lactate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=lldD PE=3 SV=1 132 446 5.0E-22
sp|B5EXA8|LLDD_SALA4 L-lactate dehydrogenase OS=Salmonella agona (strain SL483) GN=lldD PE=3 SV=1 132 446 5.0E-22
sp|A9MLC3|LLDD_SALAR L-lactate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lldD PE=3 SV=1 132 446 5.0E-22
sp|B5RGI4|LLDD_SALG2 L-lactate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lldD PE=3 SV=1 132 446 6.0E-22
sp|B5R5C7|LLDD_SALEP L-lactate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=lldD PE=3 SV=1 132 446 6.0E-22
sp|B4TZU7|LLDD_SALSV L-lactate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=lldD PE=3 SV=1 132 446 7.0E-22
sp|B4SXA4|LLDD_SALNS L-lactate dehydrogenase OS=Salmonella newport (strain SL254) GN=lldD PE=3 SV=1 132 446 8.0E-22
sp|A9IN89|LLDD_BART1 L-lactate dehydrogenase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=lldD PE=3 SV=1 107 446 2.0E-21
sp|Q8Z2E5|LLDD_SALTI L-lactate dehydrogenase OS=Salmonella typhi GN=lldD PE=3 SV=1 132 446 2.0E-21
sp|Q6G0J2|LLDD_BARQU L-lactate dehydrogenase OS=Bartonella quintana (strain Toulouse) GN=lldD PE=3 SV=1 107 446 1.0E-20
sp|P9WND7|MFTD_MYCTU Putative mycofactocin system heme/flavin oxidoreductase MftD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mftD PE=1 SV=1 303 451 2.0E-20
sp|P9WND6|MFTD_MYCTO Putative mycofactocin system heme/flavin oxidoreductase MftD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mftD PE=3 SV=1 303 451 2.0E-20
sp|A8GIL1|LLDD_SERP5 L-lactate dehydrogenase OS=Serratia proteamaculans (strain 568) GN=lldD PE=3 SV=1 107 446 3.0E-20
sp|B0T7X2|LLDD_CAUSK L-lactate dehydrogenase OS=Caulobacter sp. (strain K31) GN=lldD PE=3 SV=1 143 446 9.0E-19
sp|Q9A943|LLDD_CAUCR L-lactate dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lldD PE=3 SV=1 143 454 3.0E-18
sp|B8H3Q5|LLDD_CAUCN L-lactate dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lldD PE=3 SV=1 143 454 3.0E-18
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 9 86 8.0E-14
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 9 71 2.0E-13
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 5 97 1.0E-12
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 5 60 3.0E-12
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 10 60 4.0E-12
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 5 96 5.0E-12
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 5 136 1.0E-11
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 5 58 1.0E-11
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 1 60 2.0E-11
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 5 96 2.0E-11
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 5 61 3.0E-11
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 5 105 3.0E-11
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 6 115 3.0E-11
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 5 177 3.0E-11
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 5 98 3.0E-11
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 5 183 4.0E-11
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora infestans GN=NIAA PE=3 SV=1 5 115 5.0E-11
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 5 60 5.0E-11
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 5 60 6.0E-11
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 6 93 7.0E-11
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 5 93 1.0E-10
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 9 82 1.0E-10
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 5 60 1.0E-10
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 10 60 1.0E-10
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 5 91 2.0E-10
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 5 88 2.0E-10
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 1 90 2.0E-10
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 10 60 2.0E-10
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 10 60 2.0E-10
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 5 86 3.0E-10
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 10 67 3.0E-10
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 8 67 3.0E-10
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 8 60 3.0E-10
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 8 60 3.0E-10
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 3 93 3.0E-10
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 3 93 4.0E-10
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 5 86 4.0E-10
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 6 61 5.0E-10
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 5 102 6.0E-10
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 10 60 6.0E-10
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 6 61 6.0E-10
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 5 103 7.0E-10
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 8 61 8.0E-10
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 6 93 8.0E-10
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 10 57 1.0E-09
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 5 86 1.0E-09
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 8 61 1.0E-09
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 10 60 1.0E-09
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 10 60 2.0E-09
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 8 61 2.0E-09
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 10 60 2.0E-09
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 8 85 2.0E-09
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 10 60 2.0E-09
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 10 60 3.0E-09
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 10 71 3.0E-09
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 10 71 4.0E-09
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 10 60 4.0E-09
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 9 61 4.0E-09
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 8 85 4.0E-09
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 9 80 7.0E-09
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 10 80 7.0E-09
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 10 80 9.0E-09
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 8 60 1.0E-08
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 6 76 1.0E-08
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 10 99 2.0E-08
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 10 80 3.0E-08
sp|A9SIZ6|D5FAD_PHYPA Acyl-lipid (8-3)-desaturase OS=Physcomitrella patens subsp. patens GN=DES5 PE=1 SV=1 10 62 3.0E-08
sp|Q1ZXQ5|FAD5C_DICDI Probable Delta(5) fatty acid desaturase C OS=Dictyostelium discoideum GN=DDB_G0294553 PE=3 SV=1 5 99 6.0E-08
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 6 71 9.0E-08
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 10 80 1.0E-07
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 10 54 2.0E-07
sp|Q9LXD1|RLF_ARATH Cytochrome b5 domain-containing protein RLF OS=Arabidopsis thaliana GN=RLF PE=2 SV=1 5 61 2.0E-07
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 10 95 3.0E-07
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 10 80 3.0E-07
sp|Q6WNG7|D4FAD_EUGGR Acyl-lipid (7-3)-desaturase OS=Euglena gracilis GN=D4 PE=1 SV=1 5 92 4.0E-07
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 5 58 5.0E-07
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 10 118 7.0E-07
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 5 55 1.0E-06
sp|O74875|YJ83_SCHPO Uncharacterized heme-binding protein C330.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.03c PE=1 SV=1 10 71 1.0E-06
sp|P49050|NIA_PICAN Nitrate reductase [NADPH] OS=Pichia angusta GN=YNR1 PE=1 SV=1 2 138 2.0E-06
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 10 71 2.0E-06
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 10 70 3.0E-06
sp|Q8S3C0|D4FAD_THRSP Acyl-lipid (7-3)-desaturase OS=Thraustochytrium sp. GN=Fad4 PE=1 SV=1 10 79 3.0E-06
sp|P22945|NIA_EMENI Nitrate reductase [NADPH] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niaD PE=3 SV=1 2 147 4.0E-06
sp|P36842|NIA_LEPMC Nitrate reductase [NADPH] OS=Leptosphaeria maculans GN=NIAD PE=3 SV=2 2 61 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015930 glutamate synthase activity Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0006537 glutamate biosynthetic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0008652 cellular amino acid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0043436 oxoacid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006536 glutamate metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:0003824 catalytic activity No
GO:1901605 alpha-amino acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009064 glutamine family amino acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1886
MVDVLLDVAEVAKHNTRDSCWVILYDNVYDVTDFLSSHPGGANIILKLAGRDATEDYDPVHPPGTLEENLKAEAR
LGRVSQATTTSAQGVTDSGAPPTLASLLNLDDIEVAATSRISKRAWAYYFSASDDLHSKRLNGAVYRDILLRPRV
LVDCTDCDLSTRVLGHSVRVPFFIAPAAMARLAHADGERGMARAAARFGAMQLISNNASMTPEQIVDGAPPDQVF
GWQLYVQNSREKSEAMIRRIEAMPSRFKFICLTLDAPVPGKREDDERSGLERGVGPAASEPAGGVGRQLFHGTAS
DLTWATTLPWLARHTRLPIVLKGVQTHEDGLLAAQHAPQVKAIILSNHGGRALDTAPPPVHTLLEIRKYCPEVFN
GVEVWIDGGIRRGTDVVKALCLGATAVGLGRAPLFGLGAGGQAGVERMFEILEAETATCMRLLGASKISELGPHM
INSRRVERDIYDGITARL
Coding >Ophio5|1886
ATGGTCGACGTCTTGTTGGACGTGGCTGAAGTCGCCAAGCACAATACCCGCGACAGCTGCTGGGTCATCCTCTAC
GACAACGTCTACGACGTGACGGACTTTCTGTCCTCGCACCCGGGCGGGGCCAATATCATCCTCAAGCTCGCCGGC
CGCGATGCGACCGAAGACTATGACCCCGTCCATCCGCCAGGCACGCTCGAGGAGAACCTCAAGGCCGAAGCGCGG
CTGGGGCGCGTCAGTCAGGCTACGACGACGAGCGCCCAAGGGGTCACGGACAGCGGCGCGCCACCGACTCTGGCT
TCTCTGCTCAACCTCGACGACATCGAGGTGGCCGCCACCAGCCGCATCTCCAAGAGGGCTTGGGCCTATTACTTT
TCCGCCAGCGATGACCTGCACTCCAAACGGCTCAATGGCGCCGTCTACCGCGACATTCTTCTGCGGCCGCGCGTC
TTGGTCGACTGCACCGACTGCGACCTCTCGACGCGGGTGCTCGGCCACAGCGTCCGGGTGCCCTTCTTCATCGCT
CCGGCGGCAATGGCTCGGCTGGCCCATGCAGACGGCGAGCGGGGGATGGCCCGGGCAGCGGCCCGCTTCGGCGCC
ATGCAGCTCATTTCCAACAATGCTTCGATGACGCCCGAGCAGATTGTCGACGGTGCGCCGCCGGACCAGGTCTTT
GGGTGGCAGCTGTACGTACAGAATAGTCGGGAGAAGAGCGAGGCCATGATCAGACGCATCGAGGCCATGCCGTCG
CGCTTCAAGTTCATCTGTCTGACGCTCGACGCTCCCGTGCCGGGCAAGAGAGAGGACGATGAGAGGTCAGGCTTG
GAGCGGGGGGTCGGGCCGGCGGCGTCGGAGCCGGCCGGAGGCGTCGGACGACAGCTCTTTCACGGGACGGCATCG
GATCTGACGTGGGCGACGACGCTACCGTGGCTCGCACGACATACCCGCCTCCCCATCGTCCTCAAAGGCGTACAG
ACACACGAAGATGGCTTGCTGGCAGCCCAACACGCGCCCCAAGTCAAGGCCATCATCCTATCTAACCACGGAGGT
CGGGCCCTGGACACGGCGCCGCCGCCGGTGCACACGCTACTGGAGATTCGCAAGTACTGCCCGGAGGTGTTCAAC
GGGGTCGAGGTCTGGATCGACGGCGGCATTAGGCGAGGCACCGACGTGGTCAAGGCCCTGTGCCTCGGCGCCACG
GCGGTCGGACTAGGACGCGCGCCCCTATTCGGCCTCGGAGCCGGTGGTCAGGCTGGGGTAGAGCGCATGTTTGAG
ATCCTCGAGGCCGAAACGGCCACTTGCATGCGGCTGCTGGGGGCCAGCAAGATTTCGGAATTGGGGCCCCATATG
ATCAACAGCCGGCGAGTGGAGAGGGACATTTACGACGGAATTACGGCGAGGCTG
Transcript >Ophio5|1886
ATGGTCGACGTCTTGTTGGACGTGGCTGAAGTCGCCAAGCACAATACCCGCGACAGCTGCTGGGTCATCCTCTAC
GACAACGTCTACGACGTGACGGACTTTCTGTCCTCGCACCCGGGCGGGGCCAATATCATCCTCAAGCTCGCCGGC
CGCGATGCGACCGAAGACTATGACCCCGTCCATCCGCCAGGCACGCTCGAGGAGAACCTCAAGGCCGAAGCGCGG
CTGGGGCGCGTCAGTCAGGCTACGACGACGAGCGCCCAAGGGGTCACGGACAGCGGCGCGCCACCGACTCTGGCT
TCTCTGCTCAACCTCGACGACATCGAGGTGGCCGCCACCAGCCGCATCTCCAAGAGGGCTTGGGCCTATTACTTT
TCCGCCAGCGATGACCTGCACTCCAAACGGCTCAATGGCGCCGTCTACCGCGACATTCTTCTGCGGCCGCGCGTC
TTGGTCGACTGCACCGACTGCGACCTCTCGACGCGGGTGCTCGGCCACAGCGTCCGGGTGCCCTTCTTCATCGCT
CCGGCGGCAATGGCTCGGCTGGCCCATGCAGACGGCGAGCGGGGGATGGCCCGGGCAGCGGCCCGCTTCGGCGCC
ATGCAGCTCATTTCCAACAATGCTTCGATGACGCCCGAGCAGATTGTCGACGGTGCGCCGCCGGACCAGGTCTTT
GGGTGGCAGCTGTACGTACAGAATAGTCGGGAGAAGAGCGAGGCCATGATCAGACGCATCGAGGCCATGCCGTCG
CGCTTCAAGTTCATCTGTCTGACGCTCGACGCTCCCGTGCCGGGCAAGAGAGAGGACGATGAGAGGTCAGGCTTG
GAGCGGGGGGTCGGGCCGGCGGCGTCGGAGCCGGCCGGAGGCGTCGGACGACAGCTCTTTCACGGGACGGCATCG
GATCTGACGTGGGCGACGACGCTACCGTGGCTCGCACGACATACCCGCCTCCCCATCGTCCTCAAAGGCGTACAG
ACACACGAAGATGGCTTGCTGGCAGCCCAACACGCGCCCCAAGTCAAGGCCATCATCCTATCTAACCACGGAGGT
CGGGCCCTGGACACGGCGCCGCCGCCGGTGCACACGCTACTGGAGATTCGCAAGTACTGCCCGGAGGTGTTCAAC
GGGGTCGAGGTCTGGATCGACGGCGGCATTAGGCGAGGCACCGACGTGGTCAAGGCCCTGTGCCTCGGCGCCACG
GCGGTCGGACTAGGACGCGCGCCCCTATTCGGCCTCGGAGCCGGTGGTCAGGCTGGGGTAGAGCGCATGTTTGAG
ATCCTCGAGGCCGAAACGGCCACTTGCATGCGGCTGCTGGGGGCCAGCAAGATTTCGGAATTGGGGCCCCATATG
ATCAACAGCCGGCGAGTGGAGAGGGACATTTACGACGGAATTACGGCGAGGCTGTAG
Gene >Ophio5|1886
ATGGTCGACGTCTTGTTGGACGTGGCTGAAGGCAAGCGAAGCACACTGATGGTGATGATGAAGTTATGATTAGTA
TCACTGACACGTGCTCTCAAACAGTCGCCAAGCACAATACCCGCGACAGCTGCTGGGTCATCCTCTACGACAACG
TCTACGACGTGACGGACTTTCTGTCCTCGCACCCGGGCGGGGCCAATATCATCCTCAAGCTCGCCGGCCGCGATG
CGACCGAAGACTATGACCCCGTCCATCCGCCAGGCACGCTCGAGGAGAACCTCAAGGCCGAAGCGCGGCTGGGGC
GCGTCAGTCAGGCTACGACGACGAGCGCCCAAGGGGTCACGGACAGCGGCGCGCCACCGACTCTGGCTTCTCTGC
TCAACCTCGACGACATCGAGGTGGCCGCCACCAGCCGCATCTCCAAGAGGGCTTGGGCCTATTACTTTTCCGCCA
GCGATGACCTGCACTCCAAACGGCTCAATGGCGCCGTCTACCGCGACATTCTTCTGCGGCCGCGCGTCTTGGTCG
ACTGCACCGACTGCGACCTCTCGACGCGGGTGCTCGGCCACAGCGTCCGGGTGCCCTTCTTCATCGCTCCGGCGG
CAATGGCTCGGCTGGCCCATGCAGACGGCGAGCGGGGGATGGCCCGGGCAGCGGCCCGCTTCGGCGCCATGCAGC
TCATTTCCAACAATGCTTCGATGACGCCCGAGCAGATTGTCGACGGTGCGCCGCCGGACCAGGTCTTTGGGTGGC
AGCTGTACGTACAGAATAGTCGGGAGAAGAGCGAGGCCATGATCAGACGCATCGAGGCCATGCCGTCGCGCTTCA
AGTTCATCTGTCTGACGCTCGACGCTCCCGTGCCGGGCAAGAGAGAGGACGATGAGAGGTCAGGCTTGGAGCGGG
GGGTCGGGCCGGCGGCGTCGGAGCCGGCCGGAGGCGTCGGACGACAGCTCTTTCACGGGACGGCATCGGATCTGA
CGTGGGCGACGACGCTACCGTGGCTCGCACGACATACCCGCCTCCCCATCGTCCTCAAAGGCGTACAGACACACG
AAGATGGCTTGCTGGCAGCCCAACACGCGCCCCAAGTCAAGGCCATCATCCTATCTAACCACGGAGGTCGGGCCC
TGGACACGGCGCCGCCGCCGGTGCACACGCTACTGGAGATTCGCAAGTACTGCCCGGAGGTGTTCAACGGGGTCG
AGGTCTGGATCGACGGCGGCATTAGGCGAGGCACCGACGTGGTCAAGGCCCTGTGCCTCGGCGCCACGGCGGTCG
GACTAGGACGCGCGCCCCTATTCGGCCTCGGAGCCGGTGGTCAGGCTGGGGTAGAGCGCATGTTTGAGAGTAAGT
CGGCGGGCGCAATGATTTTGTGAGAGGAGGAGAAAAAAAAAAAGCAACTGACATTGGCGCCAGTCCTCGAGGCCG
AAACGGCCACTTGCATGCGGCTGCTGGGGGCCAGCAAGATTTCGGAATTGGGGCCCCATATGGTATGTTGGGCAT
TTTCGGGAGGCGGAGACGGAGGCGGAGGCGGAAATGTTGTCCTGACGCTCCGTTTTTTTTTTTTCACAGATCAAC
AGCCGGCGAGTGGAGAGGGACATTTACGACGGAATTACGGCGAGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail