Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1885
Gene name
Locationscaffold_172:9074..10314
Strand-
Gene length (bp)1240
Transcript length (bp)1035
Coding sequence length (bp)1032
Protein length (aa) 344

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12505 DUF3712 Protein of unknown function (DUF3712) 7.0E-19 119 241

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.2888 0.1462 0.2403 0.6191 0.0432 0.0019 0.4268 0.5 0.4645 0.0172

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 33 55 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1516
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3961
Ophiocordyceps australis map64 (Brazil) OphauB2|518
Ophiocordyceps camponoti-floridani Ophcf2|07260
Ophiocordyceps camponoti-rufipedis Ophun1|7439
Ophiocordyceps kimflemingae Ophio5|1885 (this protein)
Ophiocordyceps subramaniannii Hirsu2|11189

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1885
MSSDAKNMISQSENDARIKTSKSRACINHFKRFWWIHLLVAVILIVLIACLIVFVVLPKVVQSKLDAAKLDIQGV
AVLQTKANGYLMEINSTITTDGSVHADVEGFKGTLTLADVPDAKPFATLDFPPTTAESLSTVNISQPVQITDAAA
FIQFNTLFYQGKSIRVRLHGNTKVKPRGTAREVDVDFTKFLEFNGLERFQGTKVDGTVDIAARPGTPNFRGTAEI
PNNSHFTLEIGNATFTNFADDQDLGKLTINNLILYPGINKVDIEAELDQLKVLSIIRKRPYCETGIVPFKLLSTD
VVNHGEKLEYFVAALGSANQTVDMDIGRVLSKAVDGFKLSCSRG
Coding >Ophio5|1885
ATGTCTTCCGACGCAAAGAATATGATTTCACAGTCAGAAAACGACGCCCGGATAAAGACCAGCAAGAGCCGCGCT
TGCATCAACCACTTTAAGCGCTTCTGGTGGATTCACTTGCTCGTCGCCGTTATCCTCATCGTCCTCATCGCATGC
CTCATCGTCTTCGTCGTCCTGCCCAAAGTCGTCCAGAGCAAGTTGGACGCGGCCAAGCTGGATATCCAAGGCGTC
GCCGTGCTGCAGACCAAAGCCAATGGCTACTTGATGGAAATCAACTCGACCATCACCACCGATGGCTCCGTCCAC
GCCGACGTGGAAGGCTTCAAGGGGACCCTGACTCTGGCCGACGTCCCGGACGCCAAGCCCTTTGCCACCTTGGAC
TTCCCTCCCACCACGGCCGAATCGCTGTCCACGGTCAACATCAGCCAGCCGGTTCAGATCACTGATGCCGCAGCC
TTTATCCAGTTCAACACGCTCTTCTACCAGGGAAAGTCGATCCGCGTCCGACTGCACGGGAACACAAAGGTGAAG
CCTCGTGGCACTGCTAGGGAGGTTGACGTCGACTTTACCAAGTTTCTCGAGTTCAACGGCTTGGAACGCTTCCAA
GGCACAAAGGTCGACGGCACCGTCGATATCGCCGCACGCCCGGGCACCCCCAACTTCAGGGGCACGGCCGAGATC
CCCAACAACTCCCACTTCACCCTCGAGATAGGCAACGCCACGTTTACAAACTTCGCCGACGACCAGGATCTAGGC
AAACTGACCATCAATAACCTCATCCTCTACCCGGGCATCAACAAGGTCGATATCGAGGCCGAGCTCGATCAGCTC
AAGGTGCTCAGCATCATCCGCAAGAGGCCATACTGCGAGACGGGCATCGTCCCCTTTAAGCTGCTCAGCACCGAC
GTCGTCAACCATGGCGAGAAACTGGAATACTTCGTCGCCGCCCTCGGCAGCGCCAACCAGACCGTCGACATGGAC
ATTGGCCGCGTCCTGAGCAAGGCCGTCGACGGCTTCAAGCTGTCTTGCTCACGCGGC
Transcript >Ophio5|1885
ATGTCTTCCGACGCAAAGAATATGATTTCACAGTCAGAAAACGACGCCCGGATAAAGACCAGCAAGAGCCGCGCT
TGCATCAACCACTTTAAGCGCTTCTGGTGGATTCACTTGCTCGTCGCCGTTATCCTCATCGTCCTCATCGCATGC
CTCATCGTCTTCGTCGTCCTGCCCAAAGTCGTCCAGAGCAAGTTGGACGCGGCCAAGCTGGATATCCAAGGCGTC
GCCGTGCTGCAGACCAAAGCCAATGGCTACTTGATGGAAATCAACTCGACCATCACCACCGATGGCTCCGTCCAC
GCCGACGTGGAAGGCTTCAAGGGGACCCTGACTCTGGCCGACGTCCCGGACGCCAAGCCCTTTGCCACCTTGGAC
TTCCCTCCCACCACGGCCGAATCGCTGTCCACGGTCAACATCAGCCAGCCGGTTCAGATCACTGATGCCGCAGCC
TTTATCCAGTTCAACACGCTCTTCTACCAGGGAAAGTCGATCCGCGTCCGACTGCACGGGAACACAAAGGTGAAG
CCTCGTGGCACTGCTAGGGAGGTTGACGTCGACTTTACCAAGTTTCTCGAGTTCAACGGCTTGGAACGCTTCCAA
GGCACAAAGGTCGACGGCACCGTCGATATCGCCGCACGCCCGGGCACCCCCAACTTCAGGGGCACGGCCGAGATC
CCCAACAACTCCCACTTCACCCTCGAGATAGGCAACGCCACGTTTACAAACTTCGCCGACGACCAGGATCTAGGC
AAACTGACCATCAATAACCTCATCCTCTACCCGGGCATCAACAAGGTCGATATCGAGGCCGAGCTCGATCAGCTC
AAGGTGCTCAGCATCATCCGCAAGAGGCCATACTGCGAGACGGGCATCGTCCCCTTTAAGCTGCTCAGCACCGAC
GTCGTCAACCATGGCGAGAAACTGGAATACTTCGTCGCCGCCCTCGGCAGCGCCAACCAGACCGTCGACATGGAC
ATTGGCCGCGTCCTGAGCAAGGCCGTCGACGGCTTCAAGCTGTCTTGCTCACGCGGCTGA
Gene >Ophio5|1885
ATGTCTTCCGACGCAAAGAATATGATTTCACAGTCAGAAAACGACGCCCGGATAAAGACCAGCAAGAGCCGCGCT
TGCATCAACCACTTTAAGCGCTTCTGGTGGATTCACTTGCTCGTCGCCGTTATCCTCATCGTCCTCATCGCATGC
CTCATGTGAGTCGAATGGATTTCACTTTCTTCTACTGCATATCAATATAAACATATAATATACATATATGTATAT
ATATACAGTTGTTTGCCAAAAAAAAAAAAAATACTCATCTTCCTTTCCAAACAGCGTCTTCGTCGTCCTGCCCAA
AGTCGTCCAGAGCAAGTTGGACGCGGCCAAGCTGGATATCCAAGGCGTCGCCGTGCTGCAGACCAAAGCCAATGG
CTACTTGATGGAAATCAACTCGACCATCACCACCGATGGCTCCGTCCACGCCGACGTGGAAGGCTTCAAGGGGAC
CCTGACTCTGGCCGACGTCCCGGACGCCAAGCCCTTTGCCACCTTGGACTTCCCTCCCACCACGGCCGAATCGCT
GTCCACGGTCAACATCAGCCAGCCGGTTCAGATCACTGATGCCGCAGCCTTTATCCAGTTCAACACGCTCTTCTA
CCAGGGAAAGTCGATCCGCGTCCGACTGCACGGGAACACAAAGGTGAAGCCTCGTGGCACTGCTAGGGAGGTTGA
CGTCGACTTTACCAAGTTTCTCGAGTTCAACGGCTTGGAACGCTTCCAAGGCACAAAGGTCGACGGCACCGTCGA
TATCGCCGCACGCCCGGGCACCCCCAACTTCAGGGGCACGGCCGAGATCCCCAACAACTCCCACTTCACCCTCGA
GATAGTGAGTTTTTGGTCCTGTACGCTCGCGGCGCCGTTCCCTCCATGCTGACGTTCCCCCCACCTCCCCCCTCC
CCCCTTTCAGGGCAACGCCACGTTTACAAACTTCGCCGACGACCAGGATCTAGGCAAACTGACCATCAATAACCT
CATCCTCTACCCGGGCATCAACAAGGTCGATATCGAGGCCGAGCTCGATCAGCTCAAGGTGCTCAGCATCATCCG
CAAGAGGCCATACTGCGAGACGGGCATCGTCCCCTTTAAGCTGCTCAGCACCGACGTCGTCAACCATGGCGAGAA
ACTGGAATACTTCGTCGCCGCCCTCGGCAGCGCCAACCAGACCGTCGACATGGACATTGGCCGCGTCCTGAGCAA
GGCCGTCGACGGCTTCAAGCTGTCTTGCTCACGCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail