Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|188
Gene name
Locationscaffold_103:26893..29073
Strand+
Gene length (bp)2180
Transcript length (bp)2124
Coding sequence length (bp)2121
Protein length (aa) 707

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04791 LMBR1 LMBR1-like membrane protein 9.5E-106 14 512

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54TM2|LMD2B_DICDI LMBR1 domain-containing protein 2 homolog B OS=Dictyostelium discoideum GN=DDB_G0281669 PE=3 SV=1 12 623 5.0E-27
sp|O94599|YC8B_SCHPO LIMR family protein C622.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC622.11 PE=3 SV=1 49 524 8.0E-27
sp|Q7ZYA0|LMBD2_XENLA LMBR1 domain-containing protein 2 OS=Xenopus laevis GN=lmbrd2 PE=2 SV=1 82 623 8.0E-26
sp|Q54Q92|LMD2A_DICDI LMBR1 domain-containing protein 2 homolog A OS=Dictyostelium discoideum GN=DDB_G0284019 PE=3 SV=1 92 519 2.0E-22
sp|Q68DH5|LMBD2_HUMAN LMBR1 domain-containing protein 2 OS=Homo sapiens GN=LMBRD2 PE=2 SV=1 82 623 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54TM2|LMD2B_DICDI LMBR1 domain-containing protein 2 homolog B OS=Dictyostelium discoideum GN=DDB_G0281669 PE=3 SV=1 12 623 5.0E-27
sp|O94599|YC8B_SCHPO LIMR family protein C622.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC622.11 PE=3 SV=1 49 524 8.0E-27
sp|Q7ZYA0|LMBD2_XENLA LMBR1 domain-containing protein 2 OS=Xenopus laevis GN=lmbrd2 PE=2 SV=1 82 623 8.0E-26
sp|Q54Q92|LMD2A_DICDI LMBR1 domain-containing protein 2 homolog A OS=Dictyostelium discoideum GN=DDB_G0284019 PE=3 SV=1 92 519 2.0E-22
sp|Q68DH5|LMBD2_HUMAN LMBR1 domain-containing protein 2 OS=Homo sapiens GN=LMBRD2 PE=2 SV=1 82 623 1.0E-20
sp|Q29BL9|LMBD2_DROPS LMBR1 domain-containing protein 2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA20843 PE=3 SV=1 65 514 2.0E-19
sp|Q8MRQ4|LMBD2_DROME LMBR1 domain-containing protein 2 homolog OS=Drosophila melanogaster GN=CG8135 PE=2 SV=2 83 514 2.0E-19
sp|Q8C561|LMBD2_MOUSE LMBR1 domain-containing protein 2 OS=Mus musculus GN=Lmbrd2 PE=1 SV=1 82 528 1.0E-18
sp|Q6P4P2|LMD2B_DANRE LMBR1 domain-containing protein 2-B OS=Danio rerio GN=lmbrd2b PE=2 SV=1 56 519 2.0E-17
sp|Q5F3F5|LMBD2_CHICK LMBR1 domain-containing protein 2 OS=Gallus gallus GN=LMBRD2 PE=2 SV=1 82 384 6.0E-17
sp|Q61ZW5|LMBD2_CAEBR LMBR1 domain-containing protein 2 homolog OS=Caenorhabditis briggsae GN=CBG02934 PE=3 SV=1 14 462 7.0E-11
sp|Q18695|LMBD2_CAEEL LMBR1 domain-containing protein 2 homolog OS=Caenorhabditis elegans GN=C47G2.4 PE=3 SV=1 14 462 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 15 36 21
2 43 65 22
3 89 111 22
4 132 154 22
5 164 186 22
6 356 378 22
7 400 422 22
8 443 465 22
9 495 512 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|188
MLHVTSAATPVGSTVFCLLALLFISLGVLLMLRYYLPLRSTPAFYLVPIFFALWLPSIVVILVPVDLASSAATDD
DATRGIWLPHRVILVSWRITYWLTFALTWFILPILAEYSDAGYRDPDDKLKYSLQQNAQFYAIFVLAGLGGFIYT
AIVYKLDFASLKAFVMAASYCWGLVFAIYLMGHGLVSIPRRLVRGASVSGSLRRLHALAPKVHDQMEDSLVALEE
IEEEVSEVRRRKVGSCVEFQDWIEELASLMPNQPPTTADRANSRNSVPVVITRKYLADLTRRLTRARHARSRHLD
EWNCLKGEAAEMQAILSSATSKSLDFGGSSTRTANMLTPYTRYLYYYHVAPRIRLALGGLLAVASICILWSELIR
FAIPKLSIIRLSVIHHWVGGKAQVGFAGQTISCLYICYMCAAALVSVTEVKAWRGRALVKRNTAYESAFWYSSQV
AKLCIPLSYNYVTFLTPEVYKKTTFYRFLGEQIESTAPGRWFDDLFPIILLFPVVATLFGLYGRVKRLLFGIDMV
DDDGADPSGYGTGSWREGQRLLEQDLDGDAASRRRLDTATGLTAVAGSRSRQGPILSASAARDTTVGAGSNSRPA
VTSPRPRLPPRGQFTDTEPEDDNILQILGHRMMNTIDTMETPRWLQEIGQGIKKTKWMGGDEDPFSGDGRGGDVD
FRRWFGGSGGGGGGGEGGRGRGRGGRGGRIRL
Coding >Ophio5|188
ATGCTGCACGTCACCAGCGCCGCGACGCCTGTCGGCTCGACCGTCTTCTGTCTCCTGGCACTGCTCTTCATCTCC
CTCGGAGTGCTGCTGATGCTACGATACTACCTCCCACTCCGCTCGACACCGGCCTTTTACCTCGTTCCCATATTC
TTTGCCCTGTGGCTTCCGTCTATCGTCGTCATTCTCGTCCCCGTTGACCTCGCCTCGAGCGCGGCTACGGACGAC
GATGCCACAAGAGGCATATGGCTTCCTCACCGTGTTATCTTGGTGTCATGGAGGATCACGTATTGGCTGACGTTT
GCCCTGACTTGGTTCATTCTTCCCATCCTTGCCGAGTACTCCGACGCTGGCTATCGCGATCCCGACGACAAGCTG
AAATACTCGTTGCAACAGAATGCCCAGTTCTATGCAATCTTCGTCCTTGCCGGGCTCGGCGGCTTCATCTACACC
GCCATCGTCTACAAACTCGACTTTGCGTCGCTCAAGGCCTTCGTCATGGCCGCCTCGTACTGCTGGGGCCTGGTC
TTTGCCATCTATCTCATGGGCCACGGACTCGTTTCGATACCGCGGCGCCTGGTCCGCGGCGCCAGTGTTAGCGGC
AGCCTACGGCGGCTCCATGCCCTGGCGCCCAAGGTCCACGATCAGATGGAAGATTCGCTCGTCGCGCTCGAAGAG
ATTGAGGAGGAAGTCTCCGAGGTCCGACGGCGCAAGGTCGGCAGTTGTGTGGAGTTTCAAGACTGGATAGAGGAG
CTGGCCAGCCTCATGCCCAATCAACCGCCGACAACGGCGGACCGGGCCAACTCGCGCAATTCGGTTCCCGTCGTC
ATCACACGAAAATACCTGGCGGATCTGACAAGACGGCTCACTCGCGCGCGTCACGCAAGGTCTCGACACTTGGAC
GAGTGGAATTGCTTGAAAGGCGAGGCCGCAGAGATGCAGGCCATACTGAGCTCGGCGACTTCCAAGAGTCTCGAC
TTTGGCGGATCATCGACTCGTACGGCCAATATGCTGACGCCTTACACGCGATATCTTTACTACTACCACGTCGCG
CCCCGCATACGCCTGGCTCTGGGCGGGCTCTTGGCGGTGGCGTCCATCTGCATCTTATGGTCGGAGCTGATCCGG
TTTGCGATTCCGAAGCTATCCATCATCCGCCTCAGTGTCATCCACCACTGGGTCGGCGGCAAGGCGCAGGTGGGA
TTCGCCGGCCAGACGATATCCTGTCTTTACATCTGCTACATGTGTGCCGCCGCGTTGGTGTCCGTCACCGAGGTC
AAGGCCTGGCGTGGGCGTGCGCTGGTGAAGAGAAACACGGCGTACGAGTCGGCGTTTTGGTACTCGTCGCAGGTG
GCCAAGCTCTGCATACCGCTCTCTTACAACTACGTGACGTTTCTGACGCCCGAGGTCTACAAGAAGACGACGTTT
TACCGTTTCCTCGGCGAGCAGATTGAATCCACAGCGCCGGGCCGCTGGTTCGACGACTTATTTCCCATCATTCTC
CTCTTCCCGGTCGTGGCAACGCTGTTTGGCTTGTACGGAAGGGTCAAGCGTCTCCTATTCGGCATCGACATGGTT
GACGACGACGGCGCCGACCCGTCCGGCTACGGCACCGGCTCCTGGCGCGAGGGTCAACGGCTGCTGGAGCAAGAT
TTGGACGGGGACGCGGCGTCCCGGCGGCGCTTGGACACGGCGACCGGGCTTACCGCTGTGGCCGGCAGCAGGTCG
CGGCAAGGTCCCATTCTCTCCGCGTCCGCAGCGAGGGACACGACGGTCGGAGCCGGCAGTAATTCTCGGCCGGCT
GTCACCTCGCCGAGGCCAAGGTTGCCTCCACGCGGGCAATTTACGGACACTGAGCCTGAGGATGACAACATATTG
CAGATTCTTGGCCATCGCATGATGAACACCATCGACACGATGGAGACCCCGCGATGGCTGCAAGAGATTGGACAG
GGAATCAAGAAGACGAAGTGGATGGGAGGAGACGAGGACCCATTTTCGGGCGATGGACGGGGTGGCGACGTTGAC
TTTCGGCGCTGGTTTGGCGGCAGCGGTGGTGGCGGAGGAGGAGGAGAAGGAGGACGAGGACGAGGACGAGGAGGA
CGAGGAGGGCGAATCCGTCTC
Transcript >Ophio5|188
ATGCTGCACGTCACCAGCGCCGCGACGCCTGTCGGCTCGACCGTCTTCTGTCTCCTGGCACTGCTCTTCATCTCC
CTCGGAGTGCTGCTGATGCTACGATACTACCTCCCACTCCGCTCGACACCGGCCTTTTACCTCGTTCCCATATTC
TTTGCCCTGTGGCTTCCGTCTATCGTCGTCATTCTCGTCCCCGTTGACCTCGCCTCGAGCGCGGCTACGGACGAC
GATGCCACAAGAGGCATATGGCTTCCTCACCGTGTTATCTTGGTGTCATGGAGGATCACGTATTGGCTGACGTTT
GCCCTGACTTGGTTCATTCTTCCCATCCTTGCCGAGTACTCCGACGCTGGCTATCGCGATCCCGACGACAAGCTG
AAATACTCGTTGCAACAGAATGCCCAGTTCTATGCAATCTTCGTCCTTGCCGGGCTCGGCGGCTTCATCTACACC
GCCATCGTCTACAAACTCGACTTTGCGTCGCTCAAGGCCTTCGTCATGGCCGCCTCGTACTGCTGGGGCCTGGTC
TTTGCCATCTATCTCATGGGCCACGGACTCGTTTCGATACCGCGGCGCCTGGTCCGCGGCGCCAGTGTTAGCGGC
AGCCTACGGCGGCTCCATGCCCTGGCGCCCAAGGTCCACGATCAGATGGAAGATTCGCTCGTCGCGCTCGAAGAG
ATTGAGGAGGAAGTCTCCGAGGTCCGACGGCGCAAGGTCGGCAGTTGTGTGGAGTTTCAAGACTGGATAGAGGAG
CTGGCCAGCCTCATGCCCAATCAACCGCCGACAACGGCGGACCGGGCCAACTCGCGCAATTCGGTTCCCGTCGTC
ATCACACGAAAATACCTGGCGGATCTGACAAGACGGCTCACTCGCGCGCGTCACGCAAGGTCTCGACACTTGGAC
GAGTGGAATTGCTTGAAAGGCGAGGCCGCAGAGATGCAGGCCATACTGAGCTCGGCGACTTCCAAGAGTCTCGAC
TTTGGCGGATCATCGACTCGTACGGCCAATATGCTGACGCCTTACACGCGATATCTTTACTACTACCACGTCGCG
CCCCGCATACGCCTGGCTCTGGGCGGGCTCTTGGCGGTGGCGTCCATCTGCATCTTATGGTCGGAGCTGATCCGG
TTTGCGATTCCGAAGCTATCCATCATCCGCCTCAGTGTCATCCACCACTGGGTCGGCGGCAAGGCGCAGGTGGGA
TTCGCCGGCCAGACGATATCCTGTCTTTACATCTGCTACATGTGTGCCGCCGCGTTGGTGTCCGTCACCGAGGTC
AAGGCCTGGCGTGGGCGTGCGCTGGTGAAGAGAAACACGGCGTACGAGTCGGCGTTTTGGTACTCGTCGCAGGTG
GCCAAGCTCTGCATACCGCTCTCTTACAACTACGTGACGTTTCTGACGCCCGAGGTCTACAAGAAGACGACGTTT
TACCGTTTCCTCGGCGAGCAGATTGAATCCACAGCGCCGGGCCGCTGGTTCGACGACTTATTTCCCATCATTCTC
CTCTTCCCGGTCGTGGCAACGCTGTTTGGCTTGTACGGAAGGGTCAAGCGTCTCCTATTCGGCATCGACATGGTT
GACGACGACGGCGCCGACCCGTCCGGCTACGGCACCGGCTCCTGGCGCGAGGGTCAACGGCTGCTGGAGCAAGAT
TTGGACGGGGACGCGGCGTCCCGGCGGCGCTTGGACACGGCGACCGGGCTTACCGCTGTGGCCGGCAGCAGGTCG
CGGCAAGGTCCCATTCTCTCCGCGTCCGCAGCGAGGGACACGACGGTCGGAGCCGGCAGTAATTCTCGGCCGGCT
GTCACCTCGCCGAGGCCAAGGTTGCCTCCACGCGGGCAATTTACGGACACTGAGCCTGAGGATGACAACATATTG
CAGATTCTTGGCCATCGCATGATGAACACCATCGACACGATGGAGACCCCGCGATGGCTGCAAGAGATTGGACAG
GGAATCAAGAAGACGAAGTGGATGGGAGGAGACGAGGACCCATTTTCGGGCGATGGACGGGGTGGCGACGTTGAC
TTTCGGCGCTGGTTTGGCGGCAGCGGTGGTGGCGGAGGAGGAGGAGAAGGAGGACGAGGACGAGGACGAGGAGGA
CGAGGAGGGCGAATCCGTCTCTAG
Gene >Ophio5|188
ATGCTGCACGTCACCAGCGCCGCGACGCCTGTCGGCTCGACCGTCTTCTGTCTCCTGGCACTGCTCTTCATCTCC
CTCGGAGTGCTGCTGATGCTACGATACTACCTCCCACTCCGCTCGACACCGGCCTTTTACCTCGTTCCCATATTC
TTTGCCCTGTGGCTTCCGTCTATCGTCGTCATTCTCGTCCCCGTTGACCTCGCCTCGAGCGCGGCTACGGACGAC
GATGCCACAAGAGGCATATGGCTTCCTCACCGTGTTATCTTGGTGTCATGGAGGATCACGTATTGGCTGACGTTT
GCCCTGACTTGGTATGCACCGCCCAAACCCAGACTTCCTTCAGCCATACATACTAATCTGAGATCAGGTTCATTC
TTCCCATCCTTGCCGAGTACTCCGACGCTGGCTATCGCGATCCCGACGACAAGCTGAAATACTCGTTGCAACAGA
ATGCCCAGTTCTATGCAATCTTCGTCCTTGCCGGGCTCGGCGGCTTCATCTACACCGCCATCGTCTACAAACTCG
ACTTTGCGTCGCTCAAGGCCTTCGTCATGGCCGCCTCGTACTGCTGGGGCCTGGTCTTTGCCATCTATCTCATGG
GCCACGGACTCGTTTCGATACCGCGGCGCCTGGTCCGCGGCGCCAGTGTTAGCGGCAGCCTACGGCGGCTCCATG
CCCTGGCGCCCAAGGTCCACGATCAGATGGAAGATTCGCTCGTCGCGCTCGAAGAGATTGAGGAGGAAGTCTCCG
AGGTCCGACGGCGCAAGGTCGGCAGTTGTGTGGAGTTTCAAGACTGGATAGAGGAGCTGGCCAGCCTCATGCCCA
ATCAACCGCCGACAACGGCGGACCGGGCCAACTCGCGCAATTCGGTTCCCGTCGTCATCACACGAAAATACCTGG
CGGATCTGACAAGACGGCTCACTCGCGCGCGTCACGCAAGGTCTCGACACTTGGACGAGTGGAATTGCTTGAAAG
GCGAGGCCGCAGAGATGCAGGCCATACTGAGCTCGGCGACTTCCAAGAGTCTCGACTTTGGCGGATCATCGACTC
GTACGGCCAATATGCTGACGCCTTACACGCGATATCTTTACTACTACCACGTCGCGCCCCGCATACGCCTGGCTC
TGGGCGGGCTCTTGGCGGTGGCGTCCATCTGCATCTTATGGTCGGAGCTGATCCGGTTTGCGATTCCGAAGCTAT
CCATCATCCGCCTCAGTGTCATCCACCACTGGGTCGGCGGCAAGGCGCAGGTGGGATTCGCCGGCCAGACGATAT
CCTGTCTTTACATCTGCTACATGTGTGCCGCCGCGTTGGTGTCCGTCACCGAGGTCAAGGCCTGGCGTGGGCGTG
CGCTGGTGAAGAGAAACACGGCGTACGAGTCGGCGTTTTGGTACTCGTCGCAGGTGGCCAAGCTCTGCATACCGC
TCTCTTACAACTACGTGACGTTTCTGACGCCCGAGGTCTACAAGAAGACGACGTTTTACCGTTTCCTCGGCGAGC
AGATTGAATCCACAGCGCCGGGCCGCTGGTTCGACGACTTATTTCCCATCATTCTCCTCTTCCCGGTCGTGGCAA
CGCTGTTTGGCTTGTACGGAAGGGTCAAGCGTCTCCTATTCGGCATCGACATGGTTGACGACGACGGCGCCGACC
CGTCCGGCTACGGCACCGGCTCCTGGCGCGAGGGTCAACGGCTGCTGGAGCAAGATTTGGACGGGGACGCGGCGT
CCCGGCGGCGCTTGGACACGGCGACCGGGCTTACCGCTGTGGCCGGCAGCAGGTCGCGGCAAGGTCCCATTCTCT
CCGCGTCCGCAGCGAGGGACACGACGGTCGGAGCCGGCAGTAATTCTCGGCCGGCTGTCACCTCGCCGAGGCCAA
GGTTGCCTCCACGCGGGCAATTTACGGACACTGAGCCTGAGGATGACAACATATTGCAGATTCTTGGCCATCGCA
TGATGAACACCATCGACACGATGGAGACCCCGCGATGGCTGCAAGAGATTGGACAGGGAATCAAGAAGACGAAGT
GGATGGGAGGAGACGAGGACCCATTTTCGGGCGATGGACGGGGTGGCGACGTTGACTTTCGGCGCTGGTTTGGCG
GCAGCGGTGGTGGCGGAGGAGGAGGAGAAGGAGGACGAGGACGAGGACGAGGAGGACGAGGAGGGCGAATCCGTC
TCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail