Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1877
Gene name
Locationscaffold_171:23969..24956
Strand+
Gene length (bp)987
Transcript length (bp)801
Coding sequence length (bp)798
Protein length (aa) 266

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 6.5E-47 39 253

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide 0.1468 0.265 0.0163 0.2015 0.0728 0.0068 0.5713 0.5673 0.3713 0.0555

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 121 140 19
3 214 231 17
4 241 258 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1.34 0.00 2.91
CcL In ants, during behavior modification 424.91 195.47 654.34
CcD In ants, recently dead 151.33 82.04 220.62

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Orthologs

Orthofinder run ID4
Orthogroup6203
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03829
Ophiocordyceps camponoti-rufipedis Ophun1|3678
Ophiocordyceps kimflemingae Ophio5|1877 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6223

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1877
MGNKSGRDSETGGTQLKQRQGFVGSILQDVDIRLAYVPLLACCFVSGLTDGTIYNAYGTFVSMQTGNTIFVALGT
SGQNNKPYGWARSLCSIVFFVLGSFTFARLYQLLGGKRRGTLTFSFLSQACVVIVAAAIVQGGVVDGRYPSTRPP
SHVDFKELIIIALLSFQAAGQIVSSRSLQVGEIPTVVVTSMLCDLVSDQALFSSARNEKRTRRFWAFVLTLVGAI
CGGWISKAVHAVHPSLWTVAGIKLLIAFGWAFWKPAPQLVV
Coding >Ophio5|1877
ATGGGGAACAAGTCAGGCCGAGACTCGGAAACGGGGGGGACGCAATTGAAGCAGAGACAAGGCTTCGTAGGGAGC
ATTCTTCAAGATGTTGACATCCGGCTTGCCTATGTGCCGCTGCTGGCCTGTTGCTTCGTCTCTGGCTTGACGGAC
GGGACAATCTACAATGCGTATGGGACGTTTGTCTCCATGCAGACGGGAAACACCATCTTCGTCGCTCTCGGCACA
TCAGGTCAAAACAACAAGCCATACGGTTGGGCACGATCGCTCTGCTCCATCGTCTTCTTCGTCCTAGGATCATTT
ACCTTTGCGCGGCTATACCAGCTGCTAGGGGGTAAGAGACGAGGCACATTGACCTTTTCATTCCTCTCACAAGCT
TGTGTCGTCATCGTCGCTGCTGCCATAGTCCAGGGCGGTGTTGTAGACGGCAGGTATCCTTCAACACGACCGCCA
TCACACGTCGACTTCAAAGAGCTCATCATCATCGCCCTACTCAGTTTTCAAGCCGCTGGTCAGATTGTGAGTAGT
CGCAGTTTGCAAGTCGGCGAGATTCCGACGGTTGTGGTGACGAGTATGCTGTGCGATTTGGTTTCCGATCAGGCC
TTATTCTCCTCTGCTCGTAATGAGAAGCGGACTCGTCGCTTCTGGGCTTTTGTCCTTACTCTTGTTGGCGCCATC
TGCGGTGGCTGGATCTCCAAGGCTGTTCATGCCGTCCATCCTTCGTTGTGGACTGTGGCCGGTATCAAGCTGCTC
ATCGCCTTTGGTTGGGCCTTTTGGAAGCCGGCTCCGCAGCTGGTGGTT
Transcript >Ophio5|1877
ATGGGGAACAAGTCAGGCCGAGACTCGGAAACGGGGGGGACGCAATTGAAGCAGAGACAAGGCTTCGTAGGGAGC
ATTCTTCAAGATGTTGACATCCGGCTTGCCTATGTGCCGCTGCTGGCCTGTTGCTTCGTCTCTGGCTTGACGGAC
GGGACAATCTACAATGCGTATGGGACGTTTGTCTCCATGCAGACGGGAAACACCATCTTCGTCGCTCTCGGCACA
TCAGGTCAAAACAACAAGCCATACGGTTGGGCACGATCGCTCTGCTCCATCGTCTTCTTCGTCCTAGGATCATTT
ACCTTTGCGCGGCTATACCAGCTGCTAGGGGGTAAGAGACGAGGCACATTGACCTTTTCATTCCTCTCACAAGCT
TGTGTCGTCATCGTCGCTGCTGCCATAGTCCAGGGCGGTGTTGTAGACGGCAGGTATCCTTCAACACGACCGCCA
TCACACGTCGACTTCAAAGAGCTCATCATCATCGCCCTACTCAGTTTTCAAGCCGCTGGTCAGATTGTGAGTAGT
CGCAGTTTGCAAGTCGGCGAGATTCCGACGGTTGTGGTGACGAGTATGCTGTGCGATTTGGTTTCCGATCAGGCC
TTATTCTCCTCTGCTCGTAATGAGAAGCGGACTCGTCGCTTCTGGGCTTTTGTCCTTACTCTTGTTGGCGCCATC
TGCGGTGGCTGGATCTCCAAGGCTGTTCATGCCGTCCATCCTTCGTTGTGGACTGTGGCCGGTATCAAGCTGCTC
ATCGCCTTTGGTTGGGCCTTTTGGAAGCCGGCTCCGCAGCTGGTGGTTTGA
Gene >Ophio5|1877
ATGGGGAACAAGTCAGGCCGAGACTCGGAAACGGGGGGGACGCAATTGAAGCAGAGACAAGGCTTCGTAGGGAGC
ATTCTTCAAGATGTTGACATCCGGCTTGCCTATGTGCCGCTGCTGGCCTGTTGCTTCGTCTCTGGCTTGACGGAC
GGGACAATCTACAATGGTTGGTTACCACCCCCTTCTCCCGTCCCCCCCCCCCGGCAGACTTCATACGAGTTGAGG
CTTATATGGCGTCTTGGCAGCGTATGGGACGTTTGTCTCCATGCAGACGGGTGAGTTTCTTTACGTCTTTCCCTT
TCCGCAACTCTTTACGTCCTTCCCTTTCCCGCAATGGACGGCATCGTATCTCCAGGGTCGAGACTCAATCCCATC
AACCCAGGAAACACCATCTTCGTCGCTCTCGGCACATCAGGTCAAAACAACAAGCCATACGGTTGGGCACGATCG
CTCTGCTCCATCGTCTTCTTCGTCCTAGGATCATTTACCTTTGCGCGGCTATACCAGCTGCTAGGGGGTAAGAGA
CGAGGCACATTGACCTTTTCATTCCTCTCACAAGCTTGTGTCGTCATCGTCGCTGCTGCCATAGTCCAGGGCGGT
GTTGTAGACGGCAGGTATCCTTCAACACGACCGCCATCACACGTCGACTTCAAAGAGCTCATCATCATCGCCCTA
CTCAGTTTTCAAGCCGCTGGTCAGATTGTGAGTAGTCGCAGTTTGCAAGTCGGCGAGATTCCGACGGTTGTGGTG
ACGAGTATGCTGTGCGATTTGGTTTCCGATCAGGCCTTATTCTCCTCTGCTCGTAATGAGAAGCGGACTCGTCGC
TTCTGGGCTTTTGTCCTTACTCTTGTTGGCGCCATCTGCGGTGGCTGGATCTCCAAGGCTGTTCATGCCGTCCAT
CCTTCGTTGTGGACTGTGGCCGGTATCAAGCTGCTCATCGCCTTTGGTTGGGCCTTTTGGAAGCCGGCTCCGCAG
CTGGTGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail