Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1877
Gene name
Locationscaffold_171:23969..24956
Strand+
Gene length (bp)987
Transcript length (bp)801
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 6.5E-47 39 253

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 121 140 19
3 214 231 17
4 241 258 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1877
MGNKSGRDSETGGTQLKQRQGFVGSILQDVDIRLAYVPLLACCFVSGLTDGTIYNAYGTFVSMQTGNTIFVALGT
SGQNNKPYGWARSLCSIVFFVLGSFTFARLYQLLGGKRRGTLTFSFLSQACVVIVAAAIVQGGVVDGRYPSTRPP
SHVDFKELIIIALLSFQAAGQIVSSRSLQVGEIPTVVVTSMLCDLVSDQALFSSARNEKRTRRFWAFVLTLVGAI
CGGWISKAVHAVHPSLWTVAGIKLLIAFGWAFWKPAPQLVV
Coding >Ophio5|1877
ATGGGGAACAAGTCAGGCCGAGACTCGGAAACGGGGGGGACGCAATTGAAGCAGAGACAAGGCTTCGTAGGGAGC
ATTCTTCAAGATGTTGACATCCGGCTTGCCTATGTGCCGCTGCTGGCCTGTTGCTTCGTCTCTGGCTTGACGGAC
GGGACAATCTACAATGCGTATGGGACGTTTGTCTCCATGCAGACGGGAAACACCATCTTCGTCGCTCTCGGCACA
TCAGGTCAAAACAACAAGCCATACGGTTGGGCACGATCGCTCTGCTCCATCGTCTTCTTCGTCCTAGGATCATTT
ACCTTTGCGCGGCTATACCAGCTGCTAGGGGGTAAGAGACGAGGCACATTGACCTTTTCATTCCTCTCACAAGCT
TGTGTCGTCATCGTCGCTGCTGCCATAGTCCAGGGCGGTGTTGTAGACGGCAGGTATCCTTCAACACGACCGCCA
TCACACGTCGACTTCAAAGAGCTCATCATCATCGCCCTACTCAGTTTTCAAGCCGCTGGTCAGATTGTGAGTAGT
CGCAGTTTGCAAGTCGGCGAGATTCCGACGGTTGTGGTGACGAGTATGCTGTGCGATTTGGTTTCCGATCAGGCC
TTATTCTCCTCTGCTCGTAATGAGAAGCGGACTCGTCGCTTCTGGGCTTTTGTCCTTACTCTTGTTGGCGCCATC
TGCGGTGGCTGGATCTCCAAGGCTGTTCATGCCGTCCATCCTTCGTTGTGGACTGTGGCCGGTATCAAGCTGCTC
ATCGCCTTTGGTTGGGCCTTTTGGAAGCCGGCTCCGCAGCTGGTGGTT
Transcript >Ophio5|1877
ATGGGGAACAAGTCAGGCCGAGACTCGGAAACGGGGGGGACGCAATTGAAGCAGAGACAAGGCTTCGTAGGGAGC
ATTCTTCAAGATGTTGACATCCGGCTTGCCTATGTGCCGCTGCTGGCCTGTTGCTTCGTCTCTGGCTTGACGGAC
GGGACAATCTACAATGCGTATGGGACGTTTGTCTCCATGCAGACGGGAAACACCATCTTCGTCGCTCTCGGCACA
TCAGGTCAAAACAACAAGCCATACGGTTGGGCACGATCGCTCTGCTCCATCGTCTTCTTCGTCCTAGGATCATTT
ACCTTTGCGCGGCTATACCAGCTGCTAGGGGGTAAGAGACGAGGCACATTGACCTTTTCATTCCTCTCACAAGCT
TGTGTCGTCATCGTCGCTGCTGCCATAGTCCAGGGCGGTGTTGTAGACGGCAGGTATCCTTCAACACGACCGCCA
TCACACGTCGACTTCAAAGAGCTCATCATCATCGCCCTACTCAGTTTTCAAGCCGCTGGTCAGATTGTGAGTAGT
CGCAGTTTGCAAGTCGGCGAGATTCCGACGGTTGTGGTGACGAGTATGCTGTGCGATTTGGTTTCCGATCAGGCC
TTATTCTCCTCTGCTCGTAATGAGAAGCGGACTCGTCGCTTCTGGGCTTTTGTCCTTACTCTTGTTGGCGCCATC
TGCGGTGGCTGGATCTCCAAGGCTGTTCATGCCGTCCATCCTTCGTTGTGGACTGTGGCCGGTATCAAGCTGCTC
ATCGCCTTTGGTTGGGCCTTTTGGAAGCCGGCTCCGCAGCTGGTGGTTTGA
Gene >Ophio5|1877
ATGGGGAACAAGTCAGGCCGAGACTCGGAAACGGGGGGGACGCAATTGAAGCAGAGACAAGGCTTCGTAGGGAGC
ATTCTTCAAGATGTTGACATCCGGCTTGCCTATGTGCCGCTGCTGGCCTGTTGCTTCGTCTCTGGCTTGACGGAC
GGGACAATCTACAATGGTTGGTTACCACCCCCTTCTCCCGTCCCCCCCCCCCGGCAGACTTCATACGAGTTGAGG
CTTATATGGCGTCTTGGCAGCGTATGGGACGTTTGTCTCCATGCAGACGGGTGAGTTTCTTTACGTCTTTCCCTT
TCCGCAACTCTTTACGTCCTTCCCTTTCCCGCAATGGACGGCATCGTATCTCCAGGGTCGAGACTCAATCCCATC
AACCCAGGAAACACCATCTTCGTCGCTCTCGGCACATCAGGTCAAAACAACAAGCCATACGGTTGGGCACGATCG
CTCTGCTCCATCGTCTTCTTCGTCCTAGGATCATTTACCTTTGCGCGGCTATACCAGCTGCTAGGGGGTAAGAGA
CGAGGCACATTGACCTTTTCATTCCTCTCACAAGCTTGTGTCGTCATCGTCGCTGCTGCCATAGTCCAGGGCGGT
GTTGTAGACGGCAGGTATCCTTCAACACGACCGCCATCACACGTCGACTTCAAAGAGCTCATCATCATCGCCCTA
CTCAGTTTTCAAGCCGCTGGTCAGATTGTGAGTAGTCGCAGTTTGCAAGTCGGCGAGATTCCGACGGTTGTGGTG
ACGAGTATGCTGTGCGATTTGGTTTCCGATCAGGCCTTATTCTCCTCTGCTCGTAATGAGAAGCGGACTCGTCGC
TTCTGGGCTTTTGTCCTTACTCTTGTTGGCGCCATCTGCGGTGGCTGGATCTCCAAGGCTGTTCATGCCGTCCAT
CCTTCGTTGTGGACTGTGGCCGGTATCAAGCTGCTCATCGCCTTTGGTTGGGCCTTTTGGAAGCCGGCTCCGCAG
CTGGTGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail