Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1875
Gene name
Locationscaffold_171:19112..20670
Strand+
Gene length (bp)1558
Transcript length (bp)1494
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00899 ThiF ThiF family 8.8E-38 97 350

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36101|TCD2_YEAST tRNA threonylcarbamoyladenosine dehydratase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCD2 PE=1 SV=1 84 497 3.0E-99
sp|O13861|TCD_SCHPO tRNA threonylcarbamoyladenosine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.10 PE=3 SV=1 84 487 9.0E-90
sp|P38756|TCD1_YEAST tRNA threonylcarbamoyladenosine dehydratase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCD1 PE=1 SV=1 84 493 2.0E-76
sp|O32037|TCDA_BACSU tRNA threonylcarbamoyladenosine dehydratase OS=Bacillus subtilis (strain 168) GN=tcdA PE=3 SV=3 89 286 3.0E-25
sp|Q57097|TCDA_HAEIN tRNA threonylcarbamoyladenosine dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tcdA PE=3 SV=1 101 271 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36101|TCD2_YEAST tRNA threonylcarbamoyladenosine dehydratase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCD2 PE=1 SV=1 84 497 3.0E-99
sp|O13861|TCD_SCHPO tRNA threonylcarbamoyladenosine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.10 PE=3 SV=1 84 487 9.0E-90
sp|P38756|TCD1_YEAST tRNA threonylcarbamoyladenosine dehydratase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCD1 PE=1 SV=1 84 493 2.0E-76
sp|O32037|TCDA_BACSU tRNA threonylcarbamoyladenosine dehydratase OS=Bacillus subtilis (strain 168) GN=tcdA PE=3 SV=3 89 286 3.0E-25
sp|Q57097|TCDA_HAEIN tRNA threonylcarbamoyladenosine dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tcdA PE=3 SV=1 101 271 1.0E-23
sp|Q46927|TCDA_ECOLI tRNA threonylcarbamoyladenosine dehydratase OS=Escherichia coli (strain K12) GN=tcdA PE=1 SV=1 103 286 5.0E-17
sp|Q7PY41|MOCS3_ANOGA Adenylyltransferase and sulfurtransferase MOCS3 OS=Anopheles gambiae GN=AGAP001737 PE=3 SV=4 103 227 3.0E-12
sp|P9WMN7|MOEZ_MYCTU Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moeZ PE=1 SV=1 91 220 6.0E-12
sp|P9WMN6|MOEZ_MYCTO Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moeZ PE=3 SV=1 91 220 6.0E-12
sp|P12282|MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) GN=moeB PE=1 SV=1 104 237 3.0E-10
sp|B4LRB9|MOCS3_DROVI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila virilis GN=GJ21670 PE=3 SV=1 104 227 4.0E-10
sp|P51335|MOEB_PORPU Probable molybdopterin-synthase adenylyltransferase OS=Porphyra purpurea GN=moeB PE=3 SV=1 84 227 5.0E-10
sp|B4N7R4|MOCS3_DROWI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila willistoni GN=GK18675 PE=3 SV=1 80 229 5.0E-10
sp|A5DSR2|UBA4_LODEL Adenylyltransferase and sulfurtransferase UBA4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UBA4 PE=3 SV=1 80 239 8.0E-10
sp|Q17CA7|MOCS3_AEDAE Adenylyltransferase and sulfurtransferase MOCS3 OS=Aedes aegypti GN=AAEL004607 PE=3 SV=1 103 237 1.0E-09
sp|Q9ZNW0|MOCS3_ARATH Adenylyltransferase and sulfurtransferase MOCS3 OS=Arabidopsis thaliana GN=MOCS3 PE=2 SV=1 59 241 2.0E-09
sp|B4JBC4|MOCS3_DROGR Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila grimshawi GN=GH10959 PE=3 SV=1 104 256 4.0E-09
sp|A7THV5|UBA4_VANPO Adenylyltransferase and sulfurtransferase UBA4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=UBA4 PE=3 SV=1 103 241 4.0E-09
sp|P30138|THIF_ECOLI Sulfur carrier protein ThiS adenylyltransferase OS=Escherichia coli (strain K12) GN=thiF PE=1 SV=2 104 241 4.0E-09
sp|Q6FR35|UBA4_CANGA Adenylyltransferase and sulfurtransferase UBA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBA4 PE=3 SV=1 74 255 5.0E-09
sp|B0W377|MOCS3_CULQU Adenylyltransferase and sulfurtransferase MOCS3 OS=Culex quinquefasciatus GN=CPIJ001621 PE=3 SV=1 103 227 5.0E-09
sp|Q756K6|UBA4_ASHGO Adenylyltransferase and sulfurtransferase UBA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBA4 PE=3 SV=1 36 241 6.0E-09
sp|A1A4L8|MOCS3_BOVIN Adenylyltransferase and sulfurtransferase MOCS3 OS=Bos taurus GN=MOCS3 PE=2 SV=2 33 237 7.0E-09
sp|Q58E95|MOCS3_XENLA Adenylyltransferase and sulfurtransferase MOCS3 OS=Xenopus laevis GN=mocs3 PE=2 SV=1 103 237 7.0E-09
sp|Q59WH7|UBA4_CANAL Adenylyltransferase and sulfurtransferase UBA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBA4 PE=3 SV=1 76 245 1.0E-08
sp|B4KI53|MOCS3_DROMO Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila mojavensis GN=GI10453 PE=3 SV=1 65 245 2.0E-08
sp|A5GFZ6|MOCS3_PIG Adenylyltransferase and sulfurtransferase MOCS3 OS=Sus scrofa GN=MOCS3 PE=3 SV=1 34 237 3.0E-08
sp|A6ZT19|UBA4_YEAS7 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain YJM789) GN=UBA4 PE=3 SV=1 104 255 3.0E-08
sp|B5VK45|UBA4_YEAS6 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=UBA4 PE=3 SV=1 104 255 3.0E-08
sp|P38820|UBA4_YEAST Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA4 PE=1 SV=1 104 255 3.0E-08
sp|B3LSM6|UBA4_YEAS1 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=UBA4 PE=3 SV=1 104 255 3.0E-08
sp|O42939|UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba2 PE=1 SV=1 90 241 6.0E-08
sp|P45211|MOEB_HAEIN Molybdopterin-synthase adenylyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moeB PE=3 SV=1 91 237 6.0E-08
sp|Q6BHZ2|UBA4_DEBHA Adenylyltransferase and sulfurtransferase UBA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBA4 PE=3 SV=1 79 245 7.0E-08
sp|Q54C02|UBA5_DICDI Ubiquitin-like modifier-activating enzyme 5 OS=Dictyostelium discoideum GN=uba5 PE=3 SV=1 107 233 1.0E-07
sp|B4NXF7|MOCS3_DROYA Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila yakuba GN=GE18783 PE=3 SV=1 35 227 2.0E-07
sp|A2R3H4|UBA4_ASPNC Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=uba4 PE=3 SV=1 103 237 2.0E-07
sp|B4HYP0|MOCS3_DROSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila sechellia GN=GM17034 PE=3 SV=1 103 245 3.0E-07
sp|Q8AWD2|MOCS3_DANRE Adenylyltransferase and sulfurtransferase MOCS3 OS=Danio rerio GN=mocs3 PE=2 SV=1 30 237 3.0E-07
sp|Q9VLJ8|MOCS3_DROME Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila melanogaster GN=CG13090 PE=1 SV=1 103 245 3.0E-07
sp|P9WM11|Y1355_MYCTU Uncharacterized protein Rv1355c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1355c PE=4 SV=1 92 237 4.0E-07
sp|P9WM10|Y1355_MYCTO Uncharacterized protein MT1398 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1398 PE=4 SV=1 92 237 4.0E-07
sp|Q55FS0|UBA4_DICDI Adenylyltransferase and sulfurtransferase MOCS3 OS=Dictyostelium discoideum GN=mocs3 PE=3 SV=1 97 237 4.0E-07
sp|B0Y0P7|UBA4_ASPFC Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=uba4 PE=3 SV=1 84 237 6.0E-07
sp|O95396|MOCS3_HUMAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens GN=MOCS3 PE=1 SV=1 33 237 6.0E-07
sp|Q6B908|MOEB_GRATL Probable molybdopterin-synthase adenylyltransferase OS=Gracilaria tenuistipitata var. liui GN=moeB PE=3 SV=1 87 230 8.0E-07
sp|B6TNK6|MOC31_MAIZE Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Zea mays GN=MOCS3-1 PE=2 SV=1 103 241 8.0E-07
sp|A2BDX3|MOCS3_MOUSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Mus musculus GN=Mocs3 PE=1 SV=1 91 237 9.0E-07
sp|A4RPM5|UBA4_MAGO7 Adenylyltransferase and sulfurtransferase uba4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBA4 PE=3 SV=1 103 260 1.0E-06
sp|Q9V6U8|UBA3_DROME Nedd8-activating enzyme E1 catalytic subunit OS=Drosophila melanogaster GN=Uba3 PE=1 SV=1 113 190 1.0E-06
sp|Q4WV19|UBA4_ASPFU Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=uba4 PE=3 SV=1 84 237 2.0E-06
sp|O59954|UBA4_EMENI Adenylyltransferase and sulfurtransferase uba4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uba4 PE=1 SV=2 103 237 2.0E-06
sp|Q29PG5|MOC32_DROPS Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Drosophila pseudoobscura pseudoobscura GN=GA12041 PE=3 SV=1 103 252 2.0E-06
sp|B5DS72|MOC31_DROPS Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Drosophila pseudoobscura pseudoobscura GN=GA24966 PE=3 SV=1 103 252 2.0E-06
sp|B4GKQ3|MOCS3_DROPE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila persimilis GN=GL26133 PE=3 SV=1 103 252 2.0E-06
sp|Q56067|MOEB_SALTY Molybdopterin-synthase adenylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moeB PE=3 SV=2 125 236 4.0E-06
sp|B4FAT0|MOC32_MAIZE Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Zea mays GN=MOCS3-2 PE=2 SV=1 103 241 5.0E-06
sp|Q0CFD4|UBA4_ASPTN Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=uba4 PE=3 SV=1 97 237 5.0E-06
sp|Q6K6K7|UBA5_ORYSJ Ubiquitin-like modifier-activating enzyme 5 OS=Oryza sativa subsp. japonica GN=Os02g0506500 PE=2 SV=1 107 227 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1875
MSLFYSERLQLLVTAVVSGAAVASLIFGYQALERELRLSALKRSIPSLAEGIEESDGIRASPSAAEDEDARSLEL
ARRAQAGDFDEELILEQLARNRVFLTPQGLTKLRDAFVIVVGCGGVGSHCVASLARSGVSRMRLVDFDQVTLSSL
NRHAVATLADVGTSKVQCLRRRLAAIAPWVRFDLRPEKFQIAAAEALLGPWTDGRAPDFIVDAIDNIDTKVELLH
HCYVRGLSVISAMGAGCKSDPTRIVVGDVGTSQDDRLSRATRRRLKLLGITSGIPAVYSTEQSGEGKAELLPLPE
DEFQKGSVGDLGVMPNFRVRILPVLGTIPAIFGLTAANHVILAIAGYPTSYVVAKGRDRMYEGILAYVQGFEERL
ARLFDPETMGLKTPLTVGDVSFLCEELYQSRSIVSRIPTKLVLIRWRRPETTNMRVIGEGSHVQRSSTLRVCDLV
CMTKEEAVRHEKEIMRDRRALQELYDEETIARVEAKLSEAASYESYR
Coding >Ophio5|1875
ATGTCACTCTTTTACTCGGAGCGGCTGCAGCTGCTCGTCACCGCCGTCGTCTCCGGTGCCGCTGTTGCGTCGCTG
ATATTTGGATATCAGGCCCTAGAGAGGGAGTTGAGGCTATCAGCGCTCAAACGCTCGATTCCGTCGCTGGCAGAG
GGCATAGAAGAGTCGGATGGCATTCGAGCATCTCCATCGGCCGCCGAAGACGAGGATGCCAGGAGCCTCGAATTG
GCGCGACGGGCGCAGGCCGGCGACTTTGACGAGGAGCTGATTTTGGAGCAGCTAGCGAGGAATCGAGTTTTCCTC
ACGCCTCAGGGCCTGACGAAGCTGCGCGATGCCTTCGTCATTGTTGTTGGATGCGGCGGTGTCGGCTCGCATTGC
GTGGCATCGCTGGCGAGATCCGGCGTCTCTAGGATGCGCCTTGTCGACTTTGACCAGGTCACGCTGAGCTCTCTC
AACCGGCATGCGGTCGCAACGCTCGCCGATGTCGGAACCTCCAAGGTTCAGTGTCTCCGGAGGCGTCTCGCAGCC
ATTGCGCCCTGGGTCCGCTTCGACCTGAGGCCGGAAAAGTTCCAAATCGCTGCCGCCGAGGCGCTGCTGGGCCCA
TGGACGGACGGGCGAGCACCCGACTTCATCGTCGACGCCATCGACAACATCGACACAAAGGTCGAGCTGCTACAC
CACTGCTACGTCCGCGGGCTATCCGTCATCAGCGCCATGGGTGCTGGCTGTAAGAGCGACCCGACCCGCATCGTC
GTCGGGGATGTCGGCACCAGCCAGGACGACAGGCTATCCAGGGCGACACGGAGGCGTCTGAAACTGCTCGGCATC
ACCAGCGGAATCCCCGCCGTCTACTCGACCGAGCAGTCCGGCGAGGGCAAGGCCGAGCTGCTACCCCTGCCAGAG
GACGAGTTTCAGAAGGGGTCTGTAGGCGACCTGGGCGTCATGCCCAACTTCCGGGTGAGGATTCTGCCCGTGCTG
GGCACCATACCGGCCATATTCGGCCTCACGGCGGCAAATCACGTCATCCTGGCCATCGCCGGCTACCCGACCAGC
TACGTCGTGGCCAAGGGGCGGGACAGGATGTACGAGGGCATCCTTGCCTACGTGCAGGGCTTCGAGGAGAGGCTG
GCGAGGCTATTCGATCCGGAGACGATGGGATTAAAGACGCCGCTGACGGTGGGCGACGTGTCTTTTCTATGCGAA
GAGCTGTACCAATCCCGCAGCATCGTCAGCCGGATTCCGACCAAGCTGGTGCTCATCCGCTGGCGCCGGCCTGAG
ACGACCAACATGAGAGTCATTGGCGAGGGCAGCCATGTCCAGAGGTCCTCTACGCTGCGGGTATGTGATTTGGTC
TGCATGACCAAGGAGGAGGCTGTGCGGCACGAGAAGGAGATCATGAGGGATAGGAGGGCGCTCCAGGAATTGTAC
GATGAGGAGACGATTGCGAGGGTCGAAGCGAAGCTCTCCGAGGCGGCGAGCTATGAGAGCTACAGA
Transcript >Ophio5|1875
ATGTCACTCTTTTACTCGGAGCGGCTGCAGCTGCTCGTCACCGCCGTCGTCTCCGGTGCCGCTGTTGCGTCGCTG
ATATTTGGATATCAGGCCCTAGAGAGGGAGTTGAGGCTATCAGCGCTCAAACGCTCGATTCCGTCGCTGGCAGAG
GGCATAGAAGAGTCGGATGGCATTCGAGCATCTCCATCGGCCGCCGAAGACGAGGATGCCAGGAGCCTCGAATTG
GCGCGACGGGCGCAGGCCGGCGACTTTGACGAGGAGCTGATTTTGGAGCAGCTAGCGAGGAATCGAGTTTTCCTC
ACGCCTCAGGGCCTGACGAAGCTGCGCGATGCCTTCGTCATTGTTGTTGGATGCGGCGGTGTCGGCTCGCATTGC
GTGGCATCGCTGGCGAGATCCGGCGTCTCTAGGATGCGCCTTGTCGACTTTGACCAGGTCACGCTGAGCTCTCTC
AACCGGCATGCGGTCGCAACGCTCGCCGATGTCGGAACCTCCAAGGTTCAGTGTCTCCGGAGGCGTCTCGCAGCC
ATTGCGCCCTGGGTCCGCTTCGACCTGAGGCCGGAAAAGTTCCAAATCGCTGCCGCCGAGGCGCTGCTGGGCCCA
TGGACGGACGGGCGAGCACCCGACTTCATCGTCGACGCCATCGACAACATCGACACAAAGGTCGAGCTGCTACAC
CACTGCTACGTCCGCGGGCTATCCGTCATCAGCGCCATGGGTGCTGGCTGTAAGAGCGACCCGACCCGCATCGTC
GTCGGGGATGTCGGCACCAGCCAGGACGACAGGCTATCCAGGGCGACACGGAGGCGTCTGAAACTGCTCGGCATC
ACCAGCGGAATCCCCGCCGTCTACTCGACCGAGCAGTCCGGCGAGGGCAAGGCCGAGCTGCTACCCCTGCCAGAG
GACGAGTTTCAGAAGGGGTCTGTAGGCGACCTGGGCGTCATGCCCAACTTCCGGGTGAGGATTCTGCCCGTGCTG
GGCACCATACCGGCCATATTCGGCCTCACGGCGGCAAATCACGTCATCCTGGCCATCGCCGGCTACCCGACCAGC
TACGTCGTGGCCAAGGGGCGGGACAGGATGTACGAGGGCATCCTTGCCTACGTGCAGGGCTTCGAGGAGAGGCTG
GCGAGGCTATTCGATCCGGAGACGATGGGATTAAAGACGCCGCTGACGGTGGGCGACGTGTCTTTTCTATGCGAA
GAGCTGTACCAATCCCGCAGCATCGTCAGCCGGATTCCGACCAAGCTGGTGCTCATCCGCTGGCGCCGGCCTGAG
ACGACCAACATGAGAGTCATTGGCGAGGGCAGCCATGTCCAGAGGTCCTCTACGCTGCGGGTATGTGATTTGGTC
TGCATGACCAAGGAGGAGGCTGTGCGGCACGAGAAGGAGATCATGAGGGATAGGAGGGCGCTCCAGGAATTGTAC
GATGAGGAGACGATTGCGAGGGTCGAAGCGAAGCTCTCCGAGGCGGCGAGCTATGAGAGCTACAGATAA
Gene >Ophio5|1875
ATGTCACTCTTTTACTCGGAGCGGCTGCAGCTGCTCGTCACCGCCGTCGTCTCCGGTGCCGCTGTTGCGTCGCTG
ATATTTGGATATCAGGCCCTAGAGAGGGAGTTGAGGCTATCAGCGCTCAAACGCTCGATTCCGTCGCTGGCAGAG
GGCATAGAAGAGGTTCTCCGCGTCCAGACCGATGGTGAGACGCTTACGCTGACATTGGACTCGCCTAAACGAGCA
GTCGGATGGCATTCGAGCATCTCCATCGGCCGCCGAAGACGAGGATGCCAGGAGCCTCGAATTGGCGCGACGGGC
GCAGGCCGGCGACTTTGACGAGGAGCTGATTTTGGAGCAGCTAGCGAGGAATCGAGTTTTCCTCACGCCTCAGGG
CCTGACGAAGCTGCGCGATGCCTTCGTCATTGTTGTTGGATGCGGCGGTGTCGGCTCGCATTGCGTGGCATCGCT
GGCGAGATCCGGCGTCTCTAGGATGCGCCTTGTCGACTTTGACCAGGTCACGCTGAGCTCTCTCAACCGGCATGC
GGTCGCAACGCTCGCCGATGTCGGAACCTCCAAGGTTCAGTGTCTCCGGAGGCGTCTCGCAGCCATTGCGCCCTG
GGTCCGCTTCGACCTGAGGCCGGAAAAGTTCCAAATCGCTGCCGCCGAGGCGCTGCTGGGCCCATGGACGGACGG
GCGAGCACCCGACTTCATCGTCGACGCCATCGACAACATCGACACAAAGGTCGAGCTGCTACACCACTGCTACGT
CCGCGGGCTATCCGTCATCAGCGCCATGGGTGCTGGCTGTAAGAGCGACCCGACCCGCATCGTCGTCGGGGATGT
CGGCACCAGCCAGGACGACAGGCTATCCAGGGCGACACGGAGGCGTCTGAAACTGCTCGGCATCACCAGCGGAAT
CCCCGCCGTCTACTCGACCGAGCAGTCCGGCGAGGGCAAGGCCGAGCTGCTACCCCTGCCAGAGGACGAGTTTCA
GAAGGGGTCTGTAGGCGACCTGGGCGTCATGCCCAACTTCCGGGTGAGGATTCTGCCCGTGCTGGGCACCATACC
GGCCATATTCGGCCTCACGGCGGCAAATCACGTCATCCTGGCCATCGCCGGCTACCCGACCAGCTACGTCGTGGC
CAAGGGGCGGGACAGGATGTACGAGGGCATCCTTGCCTACGTGCAGGGCTTCGAGGAGAGGCTGGCGAGGCTATT
CGATCCGGAGACGATGGGATTAAAGACGCCGCTGACGGTGGGCGACGTGTCTTTTCTATGCGAAGAGCTGTACCA
ATCCCGCAGCATCGTCAGCCGGATTCCGACCAAGCTGGTGCTCATCCGCTGGCGCCGGCCTGAGACGACCAACAT
GAGAGTCATTGGCGAGGGCAGCCATGTCCAGAGGTCCTCTACGCTGCGGGTATGTGATTTGGTCTGCATGACCAA
GGAGGAGGCTGTGCGGCACGAGAAGGAGATCATGAGGGATAGGAGGGCGCTCCAGGAATTGTACGATGAGGAGAC
GATTGCGAGGGTCGAAGCGAAGCTCTCCGAGGCGGCGAGCTATGAGAGCTACAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail