Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1874
Gene name
Locationscaffold_171:17273..18902
Strand-
Gene length (bp)1629
Transcript length (bp)1629
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 65.52 35.61 95.43
CcL In ants, during behavior modification 59.02 31.28 86.76
CcD In ants, recently dead 48.71 26.67 70.75

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.700239 no
SC16a CcD 0.206099 no
CcL CcD 0.438414 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1874
MPLRLVVVGRLGPTAASIRLVSPMACRRCMTSQTRPAIPFLSAPTAGRGAGRRFTSARKQWLKHEAKLVVRYTLI
FWGCGLAVVVILWAFEQEAKEREFPTPHEWAWRTRNMLRSAHHSGDSDWTYTLTLARRVVMRLGNPAYDGQNVVQ
LAGRPDPTLEYPDEFIPCDISANSEDWRSGYFDAMLLSAKAAENTDGWLHDRVRNVVVPPKYVLGPSNPRPCPLP
PGFSGVPREEDCVLAYPSAENWYMKMLATVGFTPRQRVDAALAYANFLQYKGQSEAAEALYNLALVEATSKMEPA
RLPYNSKTLVLKEGGEPPSANILEALTAMANFKARKGQLSSALPMYISLLKARRRLPNHPPPPTTSNRPPPSLVQ
QVMRPPSYPESPGDGTEPPWRNSLERCQEAALHLYIGEILYATSSRVQGLAWTRDAVDLAEEQLQDRNPANMGKE
EKTRCRECLAVGLRNWSTIVAQLVQAEKAAKKKSGVESRMIPFWHEAQETPEAGSRWKSEQAVVKERAERARVLL
VDDISPQSEGLVSLLKA
Coding >Ophio5|1874
ATGCCTCTTCGGCTCGTCGTTGTTGGCCGACTCGGCCCGACGGCGGCTTCCATACGTCTCGTTTCTCCGATGGCC
TGTCGCCGATGCATGACAAGCCAGACGCGGCCTGCCATACCGTTTCTCTCCGCCCCTACAGCCGGCCGAGGGGCC
GGACGAAGATTCACATCGGCGCGGAAGCAATGGCTCAAGCACGAGGCCAAGCTAGTCGTCCGCTACACTCTCATC
TTTTGGGGCTGCGGCCTGGCCGTCGTCGTCATCCTGTGGGCCTTTGAGCAAGAGGCCAAGGAGCGCGAGTTTCCT
ACGCCGCACGAGTGGGCGTGGCGTACGAGGAATATGTTGCGCAGTGCGCATCATAGCGGCGACTCAGACTGGACT
TACACCCTGACGCTGGCCAGGCGTGTCGTAATGCGGCTGGGCAACCCGGCTTATGACGGCCAGAATGTCGTCCAA
CTGGCTGGTCGGCCGGACCCGACACTGGAGTATCCGGACGAGTTTATACCATGTGACATTTCGGCCAATTCAGAG
GACTGGCGCAGCGGCTATTTCGATGCCATGCTGCTATCCGCCAAGGCGGCCGAAAACACCGACGGATGGCTCCAT
GATCGCGTCCGCAATGTCGTCGTTCCCCCCAAATACGTCCTCGGACCTTCTAACCCCCGGCCGTGTCCTCTTCCG
CCGGGATTTTCCGGCGTCCCGCGGGAGGAGGACTGCGTGCTGGCCTATCCCTCGGCCGAAAACTGGTACATGAAG
ATGCTCGCGACCGTAGGCTTCACGCCGAGGCAAAGGGTCGACGCTGCGCTTGCATACGCCAACTTTTTGCAGTAC
AAAGGCCAGAGCGAGGCGGCCGAGGCCTTGTACAACCTGGCCTTGGTTGAGGCTACTTCCAAGATGGAGCCGGCT
CGTCTGCCGTACAACTCAAAGACTTTGGTTCTCAAAGAAGGGGGCGAACCGCCGTCAGCCAACATCCTCGAAGCC
CTCACCGCCATGGCCAACTTCAAGGCCCGTAAAGGCCAGCTCTCGTCGGCTCTCCCCATGTACATATCTCTCCTC
AAGGCACGCCGCCGCCTCCCCAATCATCCTCCCCCTCCGACGACGTCGAACCGCCCGCCTCCGTCTCTAGTCCAG
CAAGTGATGCGGCCGCCGTCGTATCCTGAATCCCCTGGAGACGGCACCGAGCCACCTTGGCGCAATTCCCTCGAG
CGCTGCCAGGAAGCGGCGCTGCATCTCTACATCGGCGAGATACTGTATGCCACATCGTCGCGGGTCCAAGGCCTG
GCCTGGACGCGGGACGCCGTCGACCTGGCGGAGGAACAGCTTCAGGATCGCAATCCGGCCAACATGGGTAAGGAG
GAAAAGACGAGGTGTCGGGAATGCCTCGCCGTAGGTCTGCGGAACTGGTCGACCATAGTGGCGCAGTTGGTCCAG
GCCGAGAAGGCGGCGAAGAAAAAGAGCGGAGTCGAGTCCAGGATGATACCCTTCTGGCACGAGGCGCAAGAGACG
CCAGAGGCCGGGAGCCGCTGGAAGAGCGAGCAGGCGGTGGTGAAGGAGCGTGCAGAGCGGGCGAGGGTGCTACTA
GTGGATGATATATCGCCGCAGTCGGAGGGTCTAGTCTCTTTGCTTAAGGCG
Transcript >Ophio5|1874
ATGCCTCTTCGGCTCGTCGTTGTTGGCCGACTCGGCCCGACGGCGGCTTCCATACGTCTCGTTTCTCCGATGGCC
TGTCGCCGATGCATGACAAGCCAGACGCGGCCTGCCATACCGTTTCTCTCCGCCCCTACAGCCGGCCGAGGGGCC
GGACGAAGATTCACATCGGCGCGGAAGCAATGGCTCAAGCACGAGGCCAAGCTAGTCGTCCGCTACACTCTCATC
TTTTGGGGCTGCGGCCTGGCCGTCGTCGTCATCCTGTGGGCCTTTGAGCAAGAGGCCAAGGAGCGCGAGTTTCCT
ACGCCGCACGAGTGGGCGTGGCGTACGAGGAATATGTTGCGCAGTGCGCATCATAGCGGCGACTCAGACTGGACT
TACACCCTGACGCTGGCCAGGCGTGTCGTAATGCGGCTGGGCAACCCGGCTTATGACGGCCAGAATGTCGTCCAA
CTGGCTGGTCGGCCGGACCCGACACTGGAGTATCCGGACGAGTTTATACCATGTGACATTTCGGCCAATTCAGAG
GACTGGCGCAGCGGCTATTTCGATGCCATGCTGCTATCCGCCAAGGCGGCCGAAAACACCGACGGATGGCTCCAT
GATCGCGTCCGCAATGTCGTCGTTCCCCCCAAATACGTCCTCGGACCTTCTAACCCCCGGCCGTGTCCTCTTCCG
CCGGGATTTTCCGGCGTCCCGCGGGAGGAGGACTGCGTGCTGGCCTATCCCTCGGCCGAAAACTGGTACATGAAG
ATGCTCGCGACCGTAGGCTTCACGCCGAGGCAAAGGGTCGACGCTGCGCTTGCATACGCCAACTTTTTGCAGTAC
AAAGGCCAGAGCGAGGCGGCCGAGGCCTTGTACAACCTGGCCTTGGTTGAGGCTACTTCCAAGATGGAGCCGGCT
CGTCTGCCGTACAACTCAAAGACTTTGGTTCTCAAAGAAGGGGGCGAACCGCCGTCAGCCAACATCCTCGAAGCC
CTCACCGCCATGGCCAACTTCAAGGCCCGTAAAGGCCAGCTCTCGTCGGCTCTCCCCATGTACATATCTCTCCTC
AAGGCACGCCGCCGCCTCCCCAATCATCCTCCCCCTCCGACGACGTCGAACCGCCCGCCTCCGTCTCTAGTCCAG
CAAGTGATGCGGCCGCCGTCGTATCCTGAATCCCCTGGAGACGGCACCGAGCCACCTTGGCGCAATTCCCTCGAG
CGCTGCCAGGAAGCGGCGCTGCATCTCTACATCGGCGAGATACTGTATGCCACATCGTCGCGGGTCCAAGGCCTG
GCCTGGACGCGGGACGCCGTCGACCTGGCGGAGGAACAGCTTCAGGATCGCAATCCGGCCAACATGGGTAAGGAG
GAAAAGACGAGGTGTCGGGAATGCCTCGCCGTAGGTCTGCGGAACTGGTCGACCATAGTGGCGCAGTTGGTCCAG
GCCGAGAAGGCGGCGAAGAAAAAGAGCGGAGTCGAGTCCAGGATGATACCCTTCTGGCACGAGGCGCAAGAGACG
CCAGAGGCCGGGAGCCGCTGGAAGAGCGAGCAGGCGGTGGTGAAGGAGCGTGCAGAGCGGGCGAGGGTGCTACTA
GTGGATGATATATCGCCGCAGTCGGAGGGTCTAGTCTCTTTGCTTAAGGCGTGA
Gene >Ophio5|1874
ATGCCTCTTCGGCTCGTCGTTGTTGGCCGACTCGGCCCGACGGCGGCTTCCATACGTCTCGTTTCTCCGATGGCC
TGTCGCCGATGCATGACAAGCCAGACGCGGCCTGCCATACCGTTTCTCTCCGCCCCTACAGCCGGCCGAGGGGCC
GGACGAAGATTCACATCGGCGCGGAAGCAATGGCTCAAGCACGAGGCCAAGCTAGTCGTCCGCTACACTCTCATC
TTTTGGGGCTGCGGCCTGGCCGTCGTCGTCATCCTGTGGGCCTTTGAGCAAGAGGCCAAGGAGCGCGAGTTTCCT
ACGCCGCACGAGTGGGCGTGGCGTACGAGGAATATGTTGCGCAGTGCGCATCATAGCGGCGACTCAGACTGGACT
TACACCCTGACGCTGGCCAGGCGTGTCGTAATGCGGCTGGGCAACCCGGCTTATGACGGCCAGAATGTCGTCCAA
CTGGCTGGTCGGCCGGACCCGACACTGGAGTATCCGGACGAGTTTATACCATGTGACATTTCGGCCAATTCAGAG
GACTGGCGCAGCGGCTATTTCGATGCCATGCTGCTATCCGCCAAGGCGGCCGAAAACACCGACGGATGGCTCCAT
GATCGCGTCCGCAATGTCGTCGTTCCCCCCAAATACGTCCTCGGACCTTCTAACCCCCGGCCGTGTCCTCTTCCG
CCGGGATTTTCCGGCGTCCCGCGGGAGGAGGACTGCGTGCTGGCCTATCCCTCGGCCGAAAACTGGTACATGAAG
ATGCTCGCGACCGTAGGCTTCACGCCGAGGCAAAGGGTCGACGCTGCGCTTGCATACGCCAACTTTTTGCAGTAC
AAAGGCCAGAGCGAGGCGGCCGAGGCCTTGTACAACCTGGCCTTGGTTGAGGCTACTTCCAAGATGGAGCCGGCT
CGTCTGCCGTACAACTCAAAGACTTTGGTTCTCAAAGAAGGGGGCGAACCGCCGTCAGCCAACATCCTCGAAGCC
CTCACCGCCATGGCCAACTTCAAGGCCCGTAAAGGCCAGCTCTCGTCGGCTCTCCCCATGTACATATCTCTCCTC
AAGGCACGCCGCCGCCTCCCCAATCATCCTCCCCCTCCGACGACGTCGAACCGCCCGCCTCCGTCTCTAGTCCAG
CAAGTGATGCGGCCGCCGTCGTATCCTGAATCCCCTGGAGACGGCACCGAGCCACCTTGGCGCAATTCCCTCGAG
CGCTGCCAGGAAGCGGCGCTGCATCTCTACATCGGCGAGATACTGTATGCCACATCGTCGCGGGTCCAAGGCCTG
GCCTGGACGCGGGACGCCGTCGACCTGGCGGAGGAACAGCTTCAGGATCGCAATCCGGCCAACATGGGTAAGGAG
GAAAAGACGAGGTGTCGGGAATGCCTCGCCGTAGGTCTGCGGAACTGGTCGACCATAGTGGCGCAGTTGGTCCAG
GCCGAGAAGGCGGCGAAGAAAAAGAGCGGAGTCGAGTCCAGGATGATACCCTTCTGGCACGAGGCGCAAGAGACG
CCAGAGGCCGGGAGCCGCTGGAAGAGCGAGCAGGCGGTGGTGAAGGAGCGTGCAGAGCGGGCGAGGGTGCTACTA
GTGGATGATATATCGCCGCAGTCGGAGGGTCTAGTCTCTTTGCTTAAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail