Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1865
Gene name
Locationscaffold_1707:122..848
Strand+
Gene length (bp)726
Transcript length (bp)726
Coding sequence length (bp)723
Protein length (aa) 241

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17242 DUF5315 Disordered region of unknown function (DUF5315) 2.8E-26 47 114

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.5871 0.4864 0.0869 0.1123 0.1437 0.0195 0.1691 0.3388 0.425 0.2759

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5317
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|395
Ophiocordyceps australis map64 (Brazil) OphauB2|8154
Ophiocordyceps camponoti-rufipedis Ophun1|592
Ophiocordyceps kimflemingae Ophio5|1865 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4937

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1865
MLETSGPDPAPSNENPELTIVKASSPTRFGISRPPGGQRSDQAFQSAKSTCSADRTDALWAEMQATLDEVELSAS
GDTHVFGPGHDRKLAALRSSQIVLAQAWARSEADDAIETAFHEFSESRLGDGVKNKPRVSQDCPRPVVGETAEMR
KSVGVGKIESEPSAGRGPKELDSKLEEETELDTFLAAQRRDANDEYFDRVNRGVIDVVTKLEDVALAMRAVEQES
KEVWNEVLSISDERAD
Coding >Ophio5|1865
ATGCTAGAAACTAGCGGTCCTGATCCTGCACCGTCGAATGAAAACCCAGAGTTGACTATCGTCAAAGCAAGCTCT
CCTACAAGATTCGGGATATCACGACCACCTGGTGGTCAACGGTCTGACCAGGCGTTTCAGAGCGCGAAAAGCACC
TGCAGTGCGGATAGGACTGATGCCCTTTGGGCTGAGATGCAAGCTACTTTAGACGAGGTTGAGCTGTCCGCTTCT
GGAGATACACATGTCTTTGGTCCCGGACATGACCGGAAGCTCGCTGCACTTCGCTCCTCCCAAATAGTCTTAGCT
CAGGCTTGGGCGAGAAGCGAAGCTGACGATGCCATCGAAACGGCGTTTCATGAATTTTCAGAATCAAGACTGGGC
GATGGGGTGAAAAACAAACCACGAGTGTCTCAAGACTGTCCGCGGCCTGTGGTCGGGGAGACCGCGGAGATGAGA
AAGAGTGTTGGAGTTGGTAAAATCGAATCTGAACCAAGCGCTGGCAGAGGACCCAAGGAGCTAGATTCAAAATTG
GAGGAAGAAACGGAACTTGACACTTTCCTTGCCGCGCAGAGGCGCGACGCAAATGACGAGTATTTTGACAGGGTC
AACAGGGGTGTCATTGACGTTGTTACCAAGTTAGAAGACGTCGCATTGGCTATGCGAGCTGTCGAACAAGAGAGT
AAAGAAGTATGGAACGAGGTTTTAAGTATAAGCGACGAGAGGGCTGAT
Transcript >Ophio5|1865
ATGCTAGAAACTAGCGGTCCTGATCCTGCACCGTCGAATGAAAACCCAGAGTTGACTATCGTCAAAGCAAGCTCT
CCTACAAGATTCGGGATATCACGACCACCTGGTGGTCAACGGTCTGACCAGGCGTTTCAGAGCGCGAAAAGCACC
TGCAGTGCGGATAGGACTGATGCCCTTTGGGCTGAGATGCAAGCTACTTTAGACGAGGTTGAGCTGTCCGCTTCT
GGAGATACACATGTCTTTGGTCCCGGACATGACCGGAAGCTCGCTGCACTTCGCTCCTCCCAAATAGTCTTAGCT
CAGGCTTGGGCGAGAAGCGAAGCTGACGATGCCATCGAAACGGCGTTTCATGAATTTTCAGAATCAAGACTGGGC
GATGGGGTGAAAAACAAACCACGAGTGTCTCAAGACTGTCCGCGGCCTGTGGTCGGGGAGACCGCGGAGATGAGA
AAGAGTGTTGGAGTTGGTAAAATCGAATCTGAACCAAGCGCTGGCAGAGGACCCAAGGAGCTAGATTCAAAATTG
GAGGAAGAAACGGAACTTGACACTTTCCTTGCCGCGCAGAGGCGCGACGCAAATGACGAGTATTTTGACAGGGTC
AACAGGGGTGTCATTGACGTTGTTACCAAGTTAGAAGACGTCGCATTGGCTATGCGAGCTGTCGAACAAGAGAGT
AAAGAAGTATGGAACGAGGTTTTAAGTATAAGCGACGAGAGGGCTGATTGA
Gene >Ophio5|1865
ATGCTAGAAACTAGCGGTCCTGATCCTGCACCGTCGAATGAAAACCCAGAGTTGACTATCGTCAAAGCAAGCTCT
CCTACAAGATTCGGGATATCACGACCACCTGGTGGTCAACGGTCTGACCAGGCGTTTCAGAGCGCGAAAAGCACC
TGCAGTGCGGATAGGACTGATGCCCTTTGGGCTGAGATGCAAGCTACTTTAGACGAGGTTGAGCTGTCCGCTTCT
GGAGATACACATGTCTTTGGTCCCGGACATGACCGGAAGCTCGCTGCACTTCGCTCCTCCCAAATAGTCTTAGCT
CAGGCTTGGGCGAGAAGCGAAGCTGACGATGCCATCGAAACGGCGTTTCATGAATTTTCAGAATCAAGACTGGGC
GATGGGGTGAAAAACAAACCACGAGTGTCTCAAGACTGTCCGCGGCCTGTGGTCGGGGAGACCGCGGAGATGAGA
AAGAGTGTTGGAGTTGGTAAAATCGAATCTGAACCAAGCGCTGGCAGAGGACCCAAGGAGCTAGATTCAAAATTG
GAGGAAGAAACGGAACTTGACACTTTCCTTGCCGCGCAGAGGCGCGACGCAAATGACGAGTATTTTGACAGGGTC
AACAGGGGTGTCATTGACGTTGTTACCAAGTTAGAAGACGTCGCATTGGCTATGCGAGCTGTCGAACAAGAGAGT
AAAGAAGTATGGAACGAGGTTTTAAGTATAAGCGACGAGAGGGCTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail