Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1863
Gene name
Locationscaffold_170:34618..35260
Strand-
Gene length (bp)642
Transcript length (bp)585
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 2.4E-10 55 151
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 5.2E-08 64 152
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 1.2E-06 96 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94340|YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.07c PE=3 SV=1 1 174 4.0E-36
sp|Q18B70|ATSE_PEPD6 Acetyltransferase CD1211 OS=Peptoclostridium difficile (strain 630) GN=CD630_12110 PE=3 SV=1 17 172 8.0E-31
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 94 170 3.0E-15
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 8 76 1.0E-07
sp|Q8CHQ9|CMLO2_MOUSE Probable N-acetyltransferase CML2 OS=Mus musculus GN=Cml2 PE=1 SV=1 64 160 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94340|YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.07c PE=3 SV=1 1 174 4.0E-36
sp|Q18B70|ATSE_PEPD6 Acetyltransferase CD1211 OS=Peptoclostridium difficile (strain 630) GN=CD630_12110 PE=3 SV=1 17 172 8.0E-31
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 94 170 3.0E-15
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 8 76 1.0E-07
sp|Q8CHQ9|CMLO2_MOUSE Probable N-acetyltransferase CML2 OS=Mus musculus GN=Cml2 PE=1 SV=1 64 160 1.0E-06
sp|Q9UHF3|NAT8B_HUMAN Putative N-acetyltransferase 8B OS=Homo sapiens GN=NAT8B PE=5 SV=1 48 159 2.0E-06
sp|Q9JIZ0|CMLO1_MOUSE Probable N-acetyltransferase CML1 OS=Mus musculus GN=Cml1 PE=1 SV=1 48 160 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016410 N-acyltransferase activity No
GO:0003674 molecular_function No
GO:0016407 acetyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1863
MARINETTIRPADWPADLNGVRACFSAYIEWLGEDLTFQDYGGEWDGLPGKYAPPAGALLLAVDGGDRILGCVAV
RPLELGPDLIGGRRRDLGVCEMKRLFVYPEARGRGLSRLLVRHAVRKAEEAGYHEMLLDTLPRMHVAIGLYASEG
FVTAEPYYHSPLPGTIYMAKRLGRENKGLFHLVLSYTRGHDPAG
Coding >Ophio5|1863
ATGGCGCGAATCAATGAGACGACCATTCGACCGGCGGACTGGCCGGCGGACCTCAACGGCGTACGGGCCTGTTTC
AGCGCCTACATCGAGTGGCTAGGCGAGGACCTCACCTTTCAGGACTACGGCGGTGAATGGGACGGGCTGCCGGGG
AAATACGCGCCGCCTGCGGGCGCCTTGCTACTGGCCGTCGACGGCGGTGACCGGATCCTCGGCTGTGTCGCCGTC
CGACCGCTCGAGCTCGGTCCGGATTTGATCGGCGGCCGGCGTCGTGACCTTGGCGTCTGCGAGATGAAGCGGCTG
TTCGTCTATCCCGAGGCTCGTGGCCGTGGCCTCTCTCGCCTCCTAGTCAGGCATGCTGTTCGGAAGGCCGAAGAG
GCGGGCTACCATGAGATGCTGCTCGATACTTTGCCGCGGATGCATGTCGCAATCGGCCTGTATGCTTCTGAGGGC
TTCGTCACGGCTGAGCCCTACTACCATAGTCCTCTTCCTGGCACTATCTATATGGCCAAGAGACTGGGCCGAGAG
AACAAAGGCCTCTTCCACCTCGTCTTGTCTTATACACGAGGACACGACCCGGCTGGC
Transcript >Ophio5|1863
ATGGCGCGAATCAATGAGACGACCATTCGACCGGCGGACTGGCCGGCGGACCTCAACGGCGTACGGGCCTGTTTC
AGCGCCTACATCGAGTGGCTAGGCGAGGACCTCACCTTTCAGGACTACGGCGGTGAATGGGACGGGCTGCCGGGG
AAATACGCGCCGCCTGCGGGCGCCTTGCTACTGGCCGTCGACGGCGGTGACCGGATCCTCGGCTGTGTCGCCGTC
CGACCGCTCGAGCTCGGTCCGGATTTGATCGGCGGCCGGCGTCGTGACCTTGGCGTCTGCGAGATGAAGCGGCTG
TTCGTCTATCCCGAGGCTCGTGGCCGTGGCCTCTCTCGCCTCCTAGTCAGGCATGCTGTTCGGAAGGCCGAAGAG
GCGGGCTACCATGAGATGCTGCTCGATACTTTGCCGCGGATGCATGTCGCAATCGGCCTGTATGCTTCTGAGGGC
TTCGTCACGGCTGAGCCCTACTACCATAGTCCTCTTCCTGGCACTATCTATATGGCCAAGAGACTGGGCCGAGAG
AACAAAGGCCTCTTCCACCTCGTCTTGTCTTATACACGAGGACACGACCCGGCTGGCTAG
Gene >Ophio5|1863
ATGGCGCGAATCAATGAGACGACCATTCGACCGGCGGACTGGCCGGCGGACCTCAACGGCGTACGGGCCTGTTTC
AGCGCCTACATCGAGTGGCTAGGCGAGGACCTCACCTTTCAGGACTACGGCGGTGAATGGGACGGGCTGCCGGGG
AAATACGCGCCGCCTGCGGGCGCCTTGCTACTGGCCGTCGACGGCGGTGACCGGATCCTCGGCTGTGTCGCCGTC
CGACCGCTCGAGCTCGGTCCGGATTTGATCGGCGGCCGGCGTCGTGACCTTGGCGTCTGCGAGATGAAGCGGCTG
TTCGTCTATCCCGAGGCTCGTGGCCGTGGCCTCTCTCGCCTCCTAGTCAGGCATGCTGTTCGGAAGGCCGAAGAG
GCGGGCTACCATGAGATGCTGCTCGATACTTTGCCGCGGATGCATGTCGCAATCGGCCTGTATGCTTCTGAGGGC
TTCGTCACGGCTGAGCCCTACTACCATAGTCCTCTTCCTGGCACTATCTATATGGCCAAGAGACTGGGCCGAGAG
AACAAGTAAAAAAAAAACGTCTACCTACCTACCTACCATCTCGGCTCATATCCTGCTCGCAGAGGCCTCTTCCAC
CTCGTCTTGTCTTATACACGAGGACACGACCCGGCTGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail