Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1853
Gene name
Locationscaffold_170:6296..8006
Strand+
Gene length (bp)1710
Transcript length (bp)1644
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 8.9E-31 152 524

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 134 536 1.0E-31
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 134 536 9.0E-30
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 177 511 2.0E-22
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 141 534 4.0E-21
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 141 534 7.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 134 536 1.0E-31
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 134 536 9.0E-30
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 177 511 2.0E-22
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 141 534 4.0E-21
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 141 534 7.0E-20
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 141 511 7.0E-19
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 284 514 1.0E-10
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 301 522 2.0E-10
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 226 525 4.0E-09
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 311 522 4.0E-09
sp|Q63688|CP7B1_RAT 25-hydroxycholesterol 7-alpha-hydroxylase (Fragment) OS=Rattus norvegicus GN=Cyp7b1 PE=1 SV=1 299 511 5.0E-09
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 277 525 6.0E-09
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 282 514 6.0E-09
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 244 540 9.0E-09
sp|Q60991|CP7B1_MOUSE 25-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp7b1 PE=2 SV=2 347 511 2.0E-08
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 320 534 3.0E-08
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 411 541 1.0E-07
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 411 541 1.0E-07
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 251 501 1.0E-07
sp|Q1ZXG3|C522A_DICDI Probable cytochrome P450 522A1 OS=Dictyostelium discoideum GN=cyp522A1 PE=3 SV=1 376 532 2.0E-07
sp|Q7Z1V1|CP51_TRYCC Sterol 14-alpha demethylase OS=Trypanosoma cruzi (strain CL Brener) GN=CYP51 PE=1 SV=1 244 534 2.0E-07
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 273 527 2.0E-07
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 251 502 5.0E-07
sp|P12939|CP2DA_RAT Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 352 533 1.0E-06
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 288 511 2.0E-06
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 411 541 2.0E-06
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 259 504 5.0E-06
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 284 511 7.0E-06
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 250 522 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1853
MTALDYLADAFGWVRVAGLCVFFTLAAYIADFVTLPRCPKQIPAFGFGRGLVAHIKNSFAHLTCHRAWVRNGYAE
YGRKGLPFALPAFISQPVDVVLPRSLTAWLMEQPESVVSAKLAHNSVLFSDYNFLSPRLIREDIAPRVASRFLPR
YLAALIPAVDEEVQHAADGALRRVSEHEWTSVNLWQLWLDIVPPVTNRILVGEGLCRDEAFIAAMVGFTDAVNRN
CLLLKMFPRALQPVVGRLLTVPNWLYWRSAHKKLAPVIQRRLVDMERQAAGDARYQAWQPPEDFITWMIRLAKQE
RKAWLLKPAELSTCLLPLEFASIHTTVLTGHSWMLDLLSMPSEAAILDVLADEIDGQAPAAGLPWTKATLQSLVR
VDSSIRESQRISNFSDTLLERVVVAPSGLRHPDFDWTLPRGIHLTVNLDGTHHDELLYEDPLVYHPLRYAHMRER
GGDGDGAKPQTLGMVSTSDRHLAFGHGRHACPGRFFVAHELKLIIAHLVRNYDFQPISQRPSSRWIGAIVVPPLG
ACIQVRRKRPRAKDLVSPMSKM
Coding >Ophio5|1853
ATGACGGCCCTCGACTACCTTGCTGATGCCTTTGGCTGGGTCCGCGTCGCAGGTCTCTGTGTTTTCTTTACTCTC
GCCGCCTACATCGCCGACTTCGTCACGCTACCACGTTGCCCCAAGCAGATCCCAGCGTTCGGCTTCGGCCGTGGC
CTCGTAGCCCACATCAAGAATAGCTTCGCTCATCTGACGTGTCACCGGGCATGGGTCCGAAACGGCTACGCAGAG
TACGGCAGAAAGGGGCTCCCCTTTGCCCTGCCCGCCTTCATCTCTCAGCCCGTCGACGTGGTACTGCCCCGGTCT
TTGACGGCATGGCTGATGGAACAGCCGGAGAGCGTGGTGAGCGCGAAGCTGGCCCACAACTCGGTCCTCTTCAGC
GACTACAACTTCTTGAGCCCCAGGCTCATCCGCGAGGACATTGCGCCCCGCGTGGCCTCGAGGTTTCTGCCCCGG
TACTTGGCGGCCCTGATACCGGCCGTTGATGAAGAAGTCCAGCACGCGGCCGATGGGGCGCTGCGTCGCGTCTCC
GAGCACGAGTGGACGAGCGTCAACCTCTGGCAACTGTGGCTCGATATCGTGCCTCCCGTCACCAACAGGATTCTC
GTGGGCGAGGGCCTGTGTCGCGATGAGGCCTTCATCGCCGCCATGGTCGGCTTCACCGATGCCGTCAACCGCAAC
TGCCTGTTGCTCAAGATGTTTCCGCGCGCGCTGCAACCCGTCGTCGGCCGTCTCCTGACCGTGCCCAACTGGCTG
TACTGGCGCTCGGCGCACAAGAAGCTGGCGCCCGTGATCCAGCGGCGTCTCGTCGACATGGAGCGTCAGGCAGCG
GGCGACGCGCGCTATCAGGCCTGGCAGCCTCCCGAGGACTTCATCACCTGGATGATCCGGCTGGCGAAGCAGGAA
CGGAAGGCCTGGCTCCTGAAGCCGGCGGAGCTCTCGACGTGCCTGCTGCCGCTCGAGTTCGCCTCGATCCACACG
ACGGTGCTGACGGGCCACTCCTGGATGCTCGACCTCTTGTCGATGCCGTCCGAAGCCGCCATCCTCGACGTGCTG
GCCGACGAGATCGACGGCCAGGCGCCGGCGGCGGGCCTCCCCTGGACCAAGGCCACGCTCCAGTCCCTCGTCCGC
GTCGACTCTTCCATCCGCGAGTCCCAGCGGATCAGCAACTTCTCCGACACGCTGCTGGAGCGCGTCGTGGTCGCG
CCGTCGGGCCTGCGTCATCCGGACTTTGACTGGACCCTCCCGCGGGGCATCCACCTCACCGTCAACCTCGACGGC
ACCCATCACGACGAGCTCCTGTACGAGGACCCGCTCGTCTACCACCCCCTGCGTTACGCCCACATGCGCGAGCGA
GGGGGCGACGGTGACGGTGCGAAGCCGCAGACGCTGGGCATGGTCAGCACCAGCGATCGTCATCTCGCTTTCGGT
CACGGGAGACATGCCTGTCCCGGCCGCTTCTTCGTCGCGCACGAGCTCAAGCTCATCATCGCTCACCTCGTCCGC
AATTACGACTTCCAACCCATCAGTCAACGGCCGTCGTCGCGCTGGATCGGCGCCATCGTCGTGCCGCCGCTTGGG
GCCTGTATCCAGGTGAGGCGGAAGCGGCCGCGGGCCAAGGACCTCGTGTCGCCCATGTCAAAGATG
Transcript >Ophio5|1853
ATGACGGCCCTCGACTACCTTGCTGATGCCTTTGGCTGGGTCCGCGTCGCAGGTCTCTGTGTTTTCTTTACTCTC
GCCGCCTACATCGCCGACTTCGTCACGCTACCACGTTGCCCCAAGCAGATCCCAGCGTTCGGCTTCGGCCGTGGC
CTCGTAGCCCACATCAAGAATAGCTTCGCTCATCTGACGTGTCACCGGGCATGGGTCCGAAACGGCTACGCAGAG
TACGGCAGAAAGGGGCTCCCCTTTGCCCTGCCCGCCTTCATCTCTCAGCCCGTCGACGTGGTACTGCCCCGGTCT
TTGACGGCATGGCTGATGGAACAGCCGGAGAGCGTGGTGAGCGCGAAGCTGGCCCACAACTCGGTCCTCTTCAGC
GACTACAACTTCTTGAGCCCCAGGCTCATCCGCGAGGACATTGCGCCCCGCGTGGCCTCGAGGTTTCTGCCCCGG
TACTTGGCGGCCCTGATACCGGCCGTTGATGAAGAAGTCCAGCACGCGGCCGATGGGGCGCTGCGTCGCGTCTCC
GAGCACGAGTGGACGAGCGTCAACCTCTGGCAACTGTGGCTCGATATCGTGCCTCCCGTCACCAACAGGATTCTC
GTGGGCGAGGGCCTGTGTCGCGATGAGGCCTTCATCGCCGCCATGGTCGGCTTCACCGATGCCGTCAACCGCAAC
TGCCTGTTGCTCAAGATGTTTCCGCGCGCGCTGCAACCCGTCGTCGGCCGTCTCCTGACCGTGCCCAACTGGCTG
TACTGGCGCTCGGCGCACAAGAAGCTGGCGCCCGTGATCCAGCGGCGTCTCGTCGACATGGAGCGTCAGGCAGCG
GGCGACGCGCGCTATCAGGCCTGGCAGCCTCCCGAGGACTTCATCACCTGGATGATCCGGCTGGCGAAGCAGGAA
CGGAAGGCCTGGCTCCTGAAGCCGGCGGAGCTCTCGACGTGCCTGCTGCCGCTCGAGTTCGCCTCGATCCACACG
ACGGTGCTGACGGGCCACTCCTGGATGCTCGACCTCTTGTCGATGCCGTCCGAAGCCGCCATCCTCGACGTGCTG
GCCGACGAGATCGACGGCCAGGCGCCGGCGGCGGGCCTCCCCTGGACCAAGGCCACGCTCCAGTCCCTCGTCCGC
GTCGACTCTTCCATCCGCGAGTCCCAGCGGATCAGCAACTTCTCCGACACGCTGCTGGAGCGCGTCGTGGTCGCG
CCGTCGGGCCTGCGTCATCCGGACTTTGACTGGACCCTCCCGCGGGGCATCCACCTCACCGTCAACCTCGACGGC
ACCCATCACGACGAGCTCCTGTACGAGGACCCGCTCGTCTACCACCCCCTGCGTTACGCCCACATGCGCGAGCGA
GGGGGCGACGGTGACGGTGCGAAGCCGCAGACGCTGGGCATGGTCAGCACCAGCGATCGTCATCTCGCTTTCGGT
CACGGGAGACATGCCTGTCCCGGCCGCTTCTTCGTCGCGCACGAGCTCAAGCTCATCATCGCTCACCTCGTCCGC
AATTACGACTTCCAACCCATCAGTCAACGGCCGTCGTCGCGCTGGATCGGCGCCATCGTCGTGCCGCCGCTTGGG
GCCTGTATCCAGGTGAGGCGGAAGCGGCCGCGGGCCAAGGACCTCGTGTCGCCCATGTCAAAGATGTAA
Gene >Ophio5|1853
ATGACGGCCCTCGACTACCTTGCTGATGCCTTTGGCTGGGTCCGCGTCGCAGGTCTCTGTGTTTTCTTTACTCTC
GCCGCCTACATCGCCGACTTCGTCACGCTACCACGTTGCCCCAAGCAGATCCCAGCGTTCGGCTTCGGCCGTGGC
CTCGTAGCCCACATCAAGAATAGCTTCGCTCATCTGACGTGTCACCGGGCATGGGTCCGAAACGGCTACGCAGAG
GTGAGCTGGCTTGTCGGCCTTGCTGATGATCAGTCTGTCAAGTCTGTTGACGCCGCCCTTACTTAGTACGGCAGA
AAGGGGCTCCCCTTTGCCCTGCCCGCCTTCATCTCTCAGCCCGTCGACGTGGTACTGCCCCGGTCTTTGACGGCA
TGGCTGATGGAACAGCCGGAGAGCGTGGTGAGCGCGAAGCTGGCCCACAACTCGGTCCTCTTCAGCGACTACAAC
TTCTTGAGCCCCAGGCTCATCCGCGAGGACATTGCGCCCCGCGTGGCCTCGAGGTTTCTGCCCCGGTACTTGGCG
GCCCTGATACCGGCCGTTGATGAAGAAGTCCAGCACGCGGCCGATGGGGCGCTGCGTCGCGTCTCCGAGCACGAG
TGGACGAGCGTCAACCTCTGGCAACTGTGGCTCGATATCGTGCCTCCCGTCACCAACAGGATTCTCGTGGGCGAG
GGCCTGTGTCGCGATGAGGCCTTCATCGCCGCCATGGTCGGCTTCACCGATGCCGTCAACCGCAACTGCCTGTTG
CTCAAGATGTTTCCGCGCGCGCTGCAACCCGTCGTCGGCCGTCTCCTGACCGTGCCCAACTGGCTGTACTGGCGC
TCGGCGCACAAGAAGCTGGCGCCCGTGATCCAGCGGCGTCTCGTCGACATGGAGCGTCAGGCAGCGGGCGACGCG
CGCTATCAGGCCTGGCAGCCTCCCGAGGACTTCATCACCTGGATGATCCGGCTGGCGAAGCAGGAACGGAAGGCC
TGGCTCCTGAAGCCGGCGGAGCTCTCGACGTGCCTGCTGCCGCTCGAGTTCGCCTCGATCCACACGACGGTGCTG
ACGGGCCACTCCTGGATGCTCGACCTCTTGTCGATGCCGTCCGAAGCCGCCATCCTCGACGTGCTGGCCGACGAG
ATCGACGGCCAGGCGCCGGCGGCGGGCCTCCCCTGGACCAAGGCCACGCTCCAGTCCCTCGTCCGCGTCGACTCT
TCCATCCGCGAGTCCCAGCGGATCAGCAACTTCTCCGACACGCTGCTGGAGCGCGTCGTGGTCGCGCCGTCGGGC
CTGCGTCATCCGGACTTTGACTGGACCCTCCCGCGGGGCATCCACCTCACCGTCAACCTCGACGGCACCCATCAC
GACGAGCTCCTGTACGAGGACCCGCTCGTCTACCACCCCCTGCGTTACGCCCACATGCGCGAGCGAGGGGGCGAC
GGTGACGGTGCGAAGCCGCAGACGCTGGGCATGGTCAGCACCAGCGATCGTCATCTCGCTTTCGGTCACGGGAGA
CATGCCTGTCCCGGCCGCTTCTTCGTCGCGCACGAGCTCAAGCTCATCATCGCTCACCTCGTCCGCAATTACGAC
TTCCAACCCATCAGTCAACGGCCGTCGTCGCGCTGGATCGGCGCCATCGTCGTGCCGCCGCTTGGGGCCTGTATC
CAGGTGAGGCGGAAGCGGCCGCGGGCCAAGGACCTCGTGTCGCCCATGTCAAAGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail