Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1850
Gene name
Locationscaffold_170:388..1947
Strand+
Gene length (bp)1559
Transcript length (bp)1506
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10445 DUF2456 Protein of unknown function (DUF2456) 8.7E-20 192 260

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74505|YJD2_SCHPO Uncharacterized protein C594.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC594.02c PE=1 SV=1 16 266 2.0E-30
sp|P38740|YHC6_YEAST Uncharacterized protein YHL026C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL026C PE=1 SV=2 76 147 1.0E-11
sp|P38740|YHC6_YEAST Uncharacterized protein YHL026C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL026C PE=1 SV=2 193 264 8.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 117 139 22
3 200 222 22
4 243 265 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1850
MHWPKRFKPDGAAAGYGSRRRTPSSAATSLPPRLHDEESRIGDDGGHDIDHHHHNGLVLNGTRLEPSSKLTAHQF
FYIFVLDGLGGLIVSGGINFGIAYAMYRRANPEKDPVRLFQLPNTLAGDGVVTIFVQCLVTWLIETTLVNYDVKH
GSVQTIGCIGEPRHWLVRSFFMLPKDPQLGAPPLRFFGVMPAIQLLVRGLLFGLVSFFPFWPIAVGILAGVGQRR
RDGDYYYDNVWTPQVYKLLLGGVLGLVTGPLMAMYWLARYGWESQTALRYAEEAAARYAEEAASRGEEGLSSPVF
GRPSEDSRKAAGSRDDRKLSGLVDGPDSDGERAPRDDEGSVDTNMKKQVDESSQVHNAAESDTASSQGDSTNQDQ
DSGEVDRRPEISSETNTSLELQGAEPAPRGPEVRASPREGATTSNEVPRYTEQVLEDIKEEPEEVEEKQAKKVGE
TAPTVEKHVLDEKAKLSQEKATEAQDEPLGRDEKSDAREASHESVEAPVAS
Coding >Ophio5|1850
ATGCACTGGCCCAAGAGATTCAAGCCGGACGGTGCGGCCGCGGGCTACGGGTCTCGACGCCGTACTCCGTCGTCG
GCGGCAACTTCGCTTCCGCCCCGTCTTCACGATGAGGAGAGTCGGATCGGGGACGATGGCGGTCATGATATCGAC
CATCATCATCATAATGGCCTTGTCTTGAACGGTACCAGGTTGGAGCCTAGCTCCAAGTTGACGGCCCATCAGTTC
TTTTACATCTTTGTACTCGACGGCTTGGGCGGATTGATAGTCTCGGGGGGCATCAACTTTGGCATCGCCTACGCC
ATGTACAGGAGGGCAAACCCGGAAAAGGACCCGGTTCGGCTCTTCCAGCTGCCCAACACGCTGGCCGGCGACGGA
GTCGTCACCATCTTCGTGCAGTGCCTCGTCACCTGGCTGATCGAGACGACGCTCGTCAACTACGATGTCAAGCAC
GGCTCCGTTCAGACCATAGGCTGCATCGGCGAACCGCGACATTGGCTTGTCCGCTCCTTTTTCATGCTACCCAAG
GATCCCCAGCTCGGGGCGCCGCCGCTGCGCTTCTTCGGAGTCATGCCGGCCATTCAGTTGCTCGTCCGCGGCCTA
CTCTTTGGCCTCGTCTCTTTCTTTCCCTTTTGGCCTATCGCTGTCGGTATCCTGGCGGGCGTAGGCCAGCGTCGC
CGCGACGGAGACTATTACTACGACAATGTCTGGACGCCTCAAGTCTACAAGCTGCTTCTCGGAGGCGTCCTCGGC
CTCGTCACGGGACCCCTCATGGCCATGTACTGGCTCGCCAGGTACGGATGGGAGTCTCAGACTGCTCTTCGTTAT
GCCGAGGAGGCGGCCGCTCGGTATGCGGAAGAAGCGGCCTCGAGGGGAGAAGAGGGCCTGTCGTCGCCTGTCTTT
GGTCGGCCATCAGAGGACAGCCGGAAAGCGGCCGGTTCGAGAGACGACAGGAAGCTTTCCGGTTTGGTGGACGGG
CCTGATTCGGACGGGGAACGGGCGCCGAGGGACGACGAGGGGAGCGTGGATACCAATATGAAGAAACAGGTCGAC
GAGTCGAGTCAAGTCCACAACGCCGCCGAAAGCGACACGGCGTCAAGTCAGGGCGACAGCACGAATCAGGATCAA
GACTCGGGAGAGGTCGACCGACGTCCCGAGATATCAAGCGAGACGAACACGTCTCTGGAGCTCCAAGGAGCCGAG
CCGGCGCCAAGAGGGCCCGAGGTCCGAGCCTCGCCGAGAGAGGGGGCAACAACATCAAACGAGGTGCCGAGATAT
ACCGAGCAGGTGCTGGAAGACATAAAGGAGGAACCGGAAGAGGTCGAGGAGAAGCAAGCCAAAAAGGTCGGAGAG
ACGGCACCAACAGTCGAAAAGCATGTGTTGGATGAGAAAGCCAAGCTCAGTCAGGAGAAGGCAACAGAGGCCCAA
GATGAGCCTCTTGGGAGAGATGAAAAGTCTGACGCCAGAGAAGCGAGCCACGAAAGTGTCGAGGCCCCAGTCGCA
TCC
Transcript >Ophio5|1850
ATGCACTGGCCCAAGAGATTCAAGCCGGACGGTGCGGCCGCGGGCTACGGGTCTCGACGCCGTACTCCGTCGTCG
GCGGCAACTTCGCTTCCGCCCCGTCTTCACGATGAGGAGAGTCGGATCGGGGACGATGGCGGTCATGATATCGAC
CATCATCATCATAATGGCCTTGTCTTGAACGGTACCAGGTTGGAGCCTAGCTCCAAGTTGACGGCCCATCAGTTC
TTTTACATCTTTGTACTCGACGGCTTGGGCGGATTGATAGTCTCGGGGGGCATCAACTTTGGCATCGCCTACGCC
ATGTACAGGAGGGCAAACCCGGAAAAGGACCCGGTTCGGCTCTTCCAGCTGCCCAACACGCTGGCCGGCGACGGA
GTCGTCACCATCTTCGTGCAGTGCCTCGTCACCTGGCTGATCGAGACGACGCTCGTCAACTACGATGTCAAGCAC
GGCTCCGTTCAGACCATAGGCTGCATCGGCGAACCGCGACATTGGCTTGTCCGCTCCTTTTTCATGCTACCCAAG
GATCCCCAGCTCGGGGCGCCGCCGCTGCGCTTCTTCGGAGTCATGCCGGCCATTCAGTTGCTCGTCCGCGGCCTA
CTCTTTGGCCTCGTCTCTTTCTTTCCCTTTTGGCCTATCGCTGTCGGTATCCTGGCGGGCGTAGGCCAGCGTCGC
CGCGACGGAGACTATTACTACGACAATGTCTGGACGCCTCAAGTCTACAAGCTGCTTCTCGGAGGCGTCCTCGGC
CTCGTCACGGGACCCCTCATGGCCATGTACTGGCTCGCCAGGTACGGATGGGAGTCTCAGACTGCTCTTCGTTAT
GCCGAGGAGGCGGCCGCTCGGTATGCGGAAGAAGCGGCCTCGAGGGGAGAAGAGGGCCTGTCGTCGCCTGTCTTT
GGTCGGCCATCAGAGGACAGCCGGAAAGCGGCCGGTTCGAGAGACGACAGGAAGCTTTCCGGTTTGGTGGACGGG
CCTGATTCGGACGGGGAACGGGCGCCGAGGGACGACGAGGGGAGCGTGGATACCAATATGAAGAAACAGGTCGAC
GAGTCGAGTCAAGTCCACAACGCCGCCGAAAGCGACACGGCGTCAAGTCAGGGCGACAGCACGAATCAGGATCAA
GACTCGGGAGAGGTCGACCGACGTCCCGAGATATCAAGCGAGACGAACACGTCTCTGGAGCTCCAAGGAGCCGAG
CCGGCGCCAAGAGGGCCCGAGGTCCGAGCCTCGCCGAGAGAGGGGGCAACAACATCAAACGAGGTGCCGAGATAT
ACCGAGCAGGTGCTGGAAGACATAAAGGAGGAACCGGAAGAGGTCGAGGAGAAGCAAGCCAAAAAGGTCGGAGAG
ACGGCACCAACAGTCGAAAAGCATGTGTTGGATGAGAAAGCCAAGCTCAGTCAGGAGAAGGCAACAGAGGCCCAA
GATGAGCCTCTTGGGAGAGATGAAAAGTCTGACGCCAGAGAAGCGAGCCACGAAAGTGTCGAGGCCCCAGTCGCA
TCCTGA
Gene >Ophio5|1850
ATGCACTGGCCCAAGAGATTCAAGCCGGACGGTGCGGCCGCGGGCTACGGGTCTCGACGCCGTACTCCGTCGTCG
GCGGCAACTTCGCTTCCGCCCCGTCTTCACGATGAGGAGAGTCGGATCGGGGACGATGGCGGTCATGATATCGAC
CATCATCATCATAATGGCCTTGTCTTGAACGGTACCAGGTTGGAGCCTAGCTCCAAGTTGACGGCCCATCAGTTC
TTTTACATCTTTGTACTCGACGGCTTGGGCGGATTGATAGTCTCGGGGGGCATCAACTTTGGCATCGCCTACGGT
GAGTCGTCTTTCTTTCCATACGCTTCAACCCGGCTTCTAACCCCTAAACAGCCATGTACAGGAGGGCAAACCCGG
AAAAGGACCCGGTTCGGCTCTTCCAGCTGCCCAACACGCTGGCCGGCGACGGAGTCGTCACCATCTTCGTGCAGT
GCCTCGTCACCTGGCTGATCGAGACGACGCTCGTCAACTACGATGTCAAGCACGGCTCCGTTCAGACCATAGGCT
GCATCGGCGAACCGCGACATTGGCTTGTCCGCTCCTTTTTCATGCTACCCAAGGATCCCCAGCTCGGGGCGCCGC
CGCTGCGCTTCTTCGGAGTCATGCCGGCCATTCAGTTGCTCGTCCGCGGCCTACTCTTTGGCCTCGTCTCTTTCT
TTCCCTTTTGGCCTATCGCTGTCGGTATCCTGGCGGGCGTAGGCCAGCGTCGCCGCGACGGAGACTATTACTACG
ACAATGTCTGGACGCCTCAAGTCTACAAGCTGCTTCTCGGAGGCGTCCTCGGCCTCGTCACGGGACCCCTCATGG
CCATGTACTGGCTCGCCAGGTACGGATGGGAGTCTCAGACTGCTCTTCGTTATGCCGAGGAGGCGGCCGCTCGGT
ATGCGGAAGAAGCGGCCTCGAGGGGAGAAGAGGGCCTGTCGTCGCCTGTCTTTGGTCGGCCATCAGAGGACAGCC
GGAAAGCGGCCGGTTCGAGAGACGACAGGAAGCTTTCCGGTTTGGTGGACGGGCCTGATTCGGACGGGGAACGGG
CGCCGAGGGACGACGAGGGGAGCGTGGATACCAATATGAAGAAACAGGTCGACGAGTCGAGTCAAGTCCACAACG
CCGCCGAAAGCGACACGGCGTCAAGTCAGGGCGACAGCACGAATCAGGATCAAGACTCGGGAGAGGTCGACCGAC
GTCCCGAGATATCAAGCGAGACGAACACGTCTCTGGAGCTCCAAGGAGCCGAGCCGGCGCCAAGAGGGCCCGAGG
TCCGAGCCTCGCCGAGAGAGGGGGCAACAACATCAAACGAGGTGCCGAGATATACCGAGCAGGTGCTGGAAGACA
TAAAGGAGGAACCGGAAGAGGTCGAGGAGAAGCAAGCCAAAAAGGTCGGAGAGACGGCACCAACAGTCGAAAAGC
ATGTGTTGGATGAGAAAGCCAAGCTCAGTCAGGAGAAGGCAACAGAGGCCCAAGATGAGCCTCTTGGGAGAGATG
AAAAGTCTGACGCCAGAGAAGCGAGCCACGAAAGTGTCGAGGCCCCAGTCGCATCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail