Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1841
Gene name
Locationscaffold_17:70521..71702
Strand-
Gene length (bp)1181
Transcript length (bp)1116
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12955 DUF3844 Domain of unknown function (DUF3844) 1.2E-35 262 365

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74728|YH93_SCHPO Uncharacterized endoplasmic reticulum membrane protein C1709.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1709.03 PE=3 SV=2 169 363 1.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 326 348 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1841
MKLNVGLLAASCGFFAAAQSVAQVYILSAREASPTTSSLSPALARLVMLQRLSGNSHGPAFQDLPEDAGVEKAVF
ALNRFGKETLPLLRGGEGGEPSQLLVMLEGVTTKHMDVLGHALGNRLAFTIADSSSSKARDEIVKIDHQTTGAKD
VSHCDLVQITNPLEECWNGQQSAFARLNVREGSDMVDNLVHRLSQLSQLAKIGELETSIVLLPWTTSAHSQPDHP
QELRRRQAEQVSLDRMAPLPTPENAALYATPARIPSCFNSKDSCVTGTQNCSGHGSCMDKYSNGGDSSAGEACYT
CHCLSTRSDSGSLTHWAGPTCAKQDISVAFWLFAGFTLALVFILWLAVSMLFNVGQERLPGVIGAGVSRAR
Coding >Ophio5|1841
ATGAAGCTCAACGTCGGCCTGTTAGCGGCCTCGTGCGGCTTCTTCGCTGCCGCTCAGTCCGTCGCACAGGTTTAC
ATCCTATCAGCCCGCGAAGCCTCTCCGACGACGTCCTCGCTCTCTCCCGCCCTAGCCCGCCTGGTCATGCTGCAG
CGGCTGAGTGGCAACAGCCACGGACCGGCTTTCCAAGACCTTCCCGAAGATGCAGGCGTCGAAAAAGCTGTTTTC
GCGCTCAACCGATTCGGAAAGGAAACGTTGCCGCTTCTCAGGGGCGGAGAGGGCGGCGAGCCCAGCCAGCTGTTG
GTGATGCTGGAAGGCGTCACGACGAAACACATGGATGTCCTGGGCCATGCGCTCGGCAACCGCCTGGCTTTCACA
ATCGCGGATTCGTCATCCTCAAAGGCCCGCGACGAGATTGTCAAAATCGACCACCAGACCACGGGTGCGAAGGAC
GTTAGTCACTGTGATCTAGTGCAGATCACCAACCCTCTGGAAGAGTGCTGGAATGGGCAGCAGTCTGCATTTGCC
AGATTGAATGTTAGAGAGGGCTCGGACATGGTCGACAACCTCGTCCACAGACTCTCCCAGCTCTCCCAGCTTGCC
AAGATAGGCGAGCTTGAGACTTCAATAGTCCTTCTGCCGTGGACCACGAGCGCCCATTCTCAGCCCGATCACCCG
CAAGAGTTGCGCAGGCGCCAGGCTGAGCAGGTCTCGCTGGACAGGATGGCGCCGTTGCCGACGCCCGAAAACGCG
GCCCTGTATGCCACACCGGCTCGCATCCCGTCGTGCTTCAACTCGAAGGACAGCTGTGTCACGGGCACTCAAAAC
TGCTCAGGCCACGGGAGTTGCATGGACAAGTATTCCAACGGAGGCGACTCCAGCGCTGGTGAAGCCTGCTATACT
TGCCACTGCCTAAGCACCAGGAGCGATTCCGGCAGCTTGACACACTGGGCCGGACCGACGTGCGCCAAGCAGGAC
ATAAGCGTTGCGTTCTGGCTCTTCGCTGGCTTTACACTCGCCCTCGTCTTCATTTTGTGGTTGGCTGTCTCGATG
CTGTTCAACGTTGGGCAAGAAAGGCTCCCGGGCGTCATTGGCGCCGGCGTCTCGCGGGCCAGA
Transcript >Ophio5|1841
ATGAAGCTCAACGTCGGCCTGTTAGCGGCCTCGTGCGGCTTCTTCGCTGCCGCTCAGTCCGTCGCACAGGTTTAC
ATCCTATCAGCCCGCGAAGCCTCTCCGACGACGTCCTCGCTCTCTCCCGCCCTAGCCCGCCTGGTCATGCTGCAG
CGGCTGAGTGGCAACAGCCACGGACCGGCTTTCCAAGACCTTCCCGAAGATGCAGGCGTCGAAAAAGCTGTTTTC
GCGCTCAACCGATTCGGAAAGGAAACGTTGCCGCTTCTCAGGGGCGGAGAGGGCGGCGAGCCCAGCCAGCTGTTG
GTGATGCTGGAAGGCGTCACGACGAAACACATGGATGTCCTGGGCCATGCGCTCGGCAACCGCCTGGCTTTCACA
ATCGCGGATTCGTCATCCTCAAAGGCCCGCGACGAGATTGTCAAAATCGACCACCAGACCACGGGTGCGAAGGAC
GTTAGTCACTGTGATCTAGTGCAGATCACCAACCCTCTGGAAGAGTGCTGGAATGGGCAGCAGTCTGCATTTGCC
AGATTGAATGTTAGAGAGGGCTCGGACATGGTCGACAACCTCGTCCACAGACTCTCCCAGCTCTCCCAGCTTGCC
AAGATAGGCGAGCTTGAGACTTCAATAGTCCTTCTGCCGTGGACCACGAGCGCCCATTCTCAGCCCGATCACCCG
CAAGAGTTGCGCAGGCGCCAGGCTGAGCAGGTCTCGCTGGACAGGATGGCGCCGTTGCCGACGCCCGAAAACGCG
GCCCTGTATGCCACACCGGCTCGCATCCCGTCGTGCTTCAACTCGAAGGACAGCTGTGTCACGGGCACTCAAAAC
TGCTCAGGCCACGGGAGTTGCATGGACAAGTATTCCAACGGAGGCGACTCCAGCGCTGGTGAAGCCTGCTATACT
TGCCACTGCCTAAGCACCAGGAGCGATTCCGGCAGCTTGACACACTGGGCCGGACCGACGTGCGCCAAGCAGGAC
ATAAGCGTTGCGTTCTGGCTCTTCGCTGGCTTTACACTCGCCCTCGTCTTCATTTTGTGGTTGGCTGTCTCGATG
CTGTTCAACGTTGGGCAAGAAAGGCTCCCGGGCGTCATTGGCGCCGGCGTCTCGCGGGCCAGATGA
Gene >Ophio5|1841
ATGAAGCTCAACGTCGGCCTGTTAGCGGCCTCGTGCGGCTTCTTCGCTGCCGCTCAGTCCGTCGCACAGGTTTAC
ATCCTATCAGCCCGCGAAGCCTCTCCGACGACGTCCTCGCTCTCTCCCGCCCTAGCCCGCCTGGTCATGCTGCAG
CGGCTGAGTGGCAACAGCCACGGACCGGCTTTCCAAGACCTTCCCGAAGATGCAGGCGTCGAAAAAGCTGTTTTC
GCGCTCAACCGATTCGGAAAGGAAACGTTGCCGCTTCTCAGGGGCGGAGAGGGCGGCGAGCCCAGCCAGCTGTTG
GTGATGCTGGAAGGCGTCACGACGAAACACATGGATGTCCTGGGCCATGCGCTCGGCAACCGCCTGGCTTTCACA
ATCGCGGATTCGTCATCCTCAAAGGCCCGCGACGAGATTGTCAAAATCGACCACCAGACCACGGGTGCGAAGGAC
GTTAGTCACTGTGATCTAGTGCAGATCACCAACCCTCTGGAAGAGTGCTGGAATGGGCAGCAGTCTGCATTTGCC
AGATTGAATGTTAGAGAGGTATATTGCTACTTTCGTTCCCGAAATGGTCGAGGCTGCCTGGAACTGACGTCAGCC
CGCTTCAGGGCTCGGACATGGTCGACAACCTCGTCCACAGACTCTCCCAGCTCTCCCAGCTTGCCAAGATAGGCG
AGCTTGAGACTTCAATAGTCCTTCTGCCGTGGACCACGAGCGCCCATTCTCAGCCCGATCACCCGCAAGAGTTGC
GCAGGCGCCAGGCTGAGCAGGTCTCGCTGGACAGGATGGCGCCGTTGCCGACGCCCGAAAACGCGGCCCTGTATG
CCACACCGGCTCGCATCCCGTCGTGCTTCAACTCGAAGGACAGCTGTGTCACGGGCACTCAAAACTGCTCAGGCC
ACGGGAGTTGCATGGACAAGTATTCCAACGGAGGCGACTCCAGCGCTGGTGAAGCCTGCTATACTTGCCACTGCC
TAAGCACCAGGAGCGATTCCGGCAGCTTGACACACTGGGCCGGACCGACGTGCGCCAAGCAGGACATAAGCGTTG
CGTTCTGGCTCTTCGCTGGCTTTACACTCGCCCTCGTCTTCATTTTGTGGTTGGCTGTCTCGATGCTGTTCAACG
TTGGGCAAGAAAGGCTCCCGGGCGTCATTGGCGCCGGCGTCTCGCGGGCCAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail