Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1835
Gene name
Locationscaffold_17:53188..55128
Strand+
Gene length (bp)1940
Transcript length (bp)1752
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.2E-42 60 544
PF07690 MFS_1 Major Facilitator Superfamily 6.8E-17 106 491

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 12 573 0.0E+00
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 14 563 0.0E+00
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 37 549 3.0E-109
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 44 560 2.0E-107
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 44 560 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 12 573 0.0E+00
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 14 563 0.0E+00
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 37 549 3.0E-109
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 44 560 2.0E-107
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 44 560 2.0E-107
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 44 579 4.0E-107
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 39 575 1.0E-106
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 36 549 2.0E-106
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 38 555 2.0E-104
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 44 549 6.0E-104
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 36 561 2.0E-103
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 44 549 1.0E-102
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 39 546 2.0E-101
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 44 549 3.0E-101
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 44 548 1.0E-99
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 37 549 1.0E-99
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 33 548 8.0E-98
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 36 549 1.0E-96
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 37 546 1.0E-95
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 37 549 2.0E-94
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 44 547 2.0E-94
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 44 572 1.0E-91
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 44 549 1.0E-87
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 32 544 4.0E-86
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 56 539 7.0E-85
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 58 544 1.0E-84
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 44 575 2.0E-84
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 27 548 3.0E-81
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 40 543 1.0E-76
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 107 495 6.0E-22
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 58 543 2.0E-17
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 5 580 1.0E-15
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 110 547 6.0E-12
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 103 579 2.0E-11
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 32 499 6.0E-11
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 110 553 2.0E-10
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 109 490 5.0E-10
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 110 545 6.0E-10
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 110 545 6.0E-10
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 94 579 8.0E-10
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 108 544 1.0E-09
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 94 544 2.0E-09
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 110 566 3.0E-09
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 100 487 5.0E-09
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 101 561 5.0E-09
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 95 357 1.0E-08
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 110 545 1.0E-08
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 95 357 1.0E-08
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 108 575 1.0E-08
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 161 553 2.0E-08
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 161 553 2.0E-08
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 108 575 2.0E-08
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 108 545 3.0E-08
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 95 357 4.0E-08
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 95 357 4.0E-08
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 95 357 5.0E-08
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 95 357 5.0E-08
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 108 583 5.0E-08
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 164 545 6.0E-08
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 108 575 7.0E-08
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 111 544 9.0E-08
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 110 548 1.0E-07
sp|Q8HY24|S22A8_RABIT Solute carrier family 22 member 8 OS=Oryctolagus cuniculus GN=SLC22A8 PE=2 SV=1 98 581 3.0E-07
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 110 549 4.0E-07
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 94 436 6.0E-07
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 110 545 7.0E-07
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 110 545 7.0E-07
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 109 576 8.0E-07
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 110 473 8.0E-07
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 164 551 1.0E-06
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 109 487 1.0E-06
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 108 575 2.0E-06
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 245 544 2.0E-06
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 47 572 3.0E-06
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 46 281 3.0E-06
sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 243 573 4.0E-06
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 47 357 6.0E-06
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 95 357 6.0E-06
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 110 284 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 131 150 19
3 160 182 22
4 195 217 22
5 244 266 22
6 379 401 22
7 414 436 22
8 441 463 22
9 515 534 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1835
MALASKPESPVKAKKTYGGNSAYHNFHNDFVHVADLNERRRLALAEVDRAPFGWYHVRACAVAGVGFFTDSYDIF
TASLLTIMLGIVYFPGIGVMPTTSDDAIKLATSAGTVVGQLGFGCLADLVGRRRMYGLELFVIIFATLGQALTSG
SPACDIIGLVIFWRVIMGIGIGGDYPLSSIITSEFATTKWRGAMMAAVFAMQGLGQLGAAMVMLFVTLGFRSQLE
AAPDIAHCDGECRVSVDRMWRTLIGFGAVPACIALYFRLTIPETPRYTFDAARDVEKAEDDVAAYLNGKPSGEHD
PVSRVATQAAAVESLDVPKASWADFLHHYSQMKNLKLLLGTAGSWFCLDVAFYGLSLNNGTILSVIGYSTKNAHN
VYQFLYNTAVGNLVIVLAGAVPGYWVSVATIDTLGRKKIQMGGFIILVAILVSMGFAYHSLSPEGLLGLYVVAQF
FFNFGPNTTTFIVPGEVFPTRYRSTSHGISAASGKIGSIIGQAAIATLRTRGATKDNPSPWMNHVLQIYALFMLL
GCFTTLLIPETARKTLEELSGEDDYATRTPAAVDQTNTTRANSPAKEQDSPHSPNGVE
Coding >Ophio5|1835
ATGGCCCTCGCCTCGAAGCCCGAGTCGCCGGTCAAGGCAAAGAAGACGTATGGCGGTAACAGTGCTTATCACAAC
TTCCATAATGACTTCGTTCATGTCGCCGATCTCAATGAGCGCCGTCGTCTCGCCCTGGCCGAGGTCGACCGCGCG
CCCTTTGGCTGGTATCATGTGCGCGCCTGCGCCGTTGCCGGCGTTGGCTTCTTCACCGACTCGTACGACATCTTC
ACGGCCTCTCTCCTGACCATCATGCTCGGCATCGTCTACTTCCCGGGCATCGGAGTCATGCCCACCACCTCGGAT
GATGCCATTAAGCTCGCCACCTCGGCCGGCACCGTCGTGGGCCAGCTCGGCTTCGGCTGCCTTGCTGACCTTGTC
GGCCGCAGGCGCATGTATGGCCTTGAACTCTTCGTCATCATCTTCGCCACCCTCGGTCAAGCCTTGACCAGCGGC
TCTCCCGCGTGCGACATCATTGGCCTCGTCATCTTCTGGCGCGTCATCATGGGCATCGGCATCGGCGGCGACTAT
CCGCTGTCGTCCATTATTACCTCAGAGTTCGCAACTACCAAGTGGAGGGGCGCCATGATGGCCGCCGTCTTCGCC
ATGCAGGGGCTCGGTCAGCTGGGCGCCGCCATGGTCATGCTCTTCGTCACTCTCGGCTTCCGTTCTCAACTCGAG
GCGGCGCCCGACATTGCCCACTGTGACGGCGAATGTCGCGTCTCGGTCGACAGGATGTGGAGGACCCTCATCGGC
TTCGGCGCCGTCCCCGCTTGCATTGCCCTGTACTTCCGCCTCACCATCCCCGAAACACCGCGCTACACCTTCGAC
GCGGCCAGAGACGTTGAAAAGGCAGAGGATGACGTTGCCGCCTACCTGAACGGCAAGCCTTCGGGCGAGCACGAT
CCCGTGTCCCGCGTCGCCACGCAGGCCGCCGCTGTCGAGAGCCTCGACGTCCCCAAGGCCAGCTGGGCCGACTTC
TTGCACCACTATTCCCAGATGAAGAATTTGAAGCTCCTCCTCGGCACCGCCGGCTCGTGGTTTTGCCTCGACGTC
GCCTTCTACGGCCTGTCCCTCAACAACGGCACCATCCTCAGCGTCATCGGCTACTCGACCAAGAACGCACACAAC
GTCTACCAGTTCCTCTACAACACCGCCGTCGGCAATCTCGTCATCGTCCTCGCCGGCGCCGTTCCGGGCTACTGG
GTGTCGGTGGCCACCATCGACACCCTGGGCCGCAAGAAGATCCAGATGGGTGGCTTCATCATCCTCGTCGCCATC
CTCGTCTCCATGGGCTTCGCCTATCATAGTCTCTCTCCGGAGGGCCTGCTGGGTCTCTACGTCGTCGCCCAGTTC
TTCTTCAACTTTGGCCCCAACACCACCACCTTCATCGTCCCTGGAGAGGTCTTCCCCACCCGCTATCGGTCCACC
TCGCACGGCATCTCCGCCGCCTCGGGCAAGATCGGCTCCATCATCGGCCAGGCCGCCATCGCCACGCTCCGCACC
CGCGGCGCCACAAAGGACAACCCTTCGCCCTGGATGAACCACGTACTCCAGATCTACGCCCTCTTCATGCTCCTC
GGTTGCTTCACCACGCTGCTGATCCCCGAGACGGCGCGAAAAACGCTCGAGGAGCTCAGCGGCGAGGACGACTAT
GCCACAAGAACGCCCGCCGCCGTGGACCAGACGAATACAACCAGGGCCAATTCGCCCGCAAAGGAACAGGATAGT
CCTCACTCACCTAATGGAGTAGAG
Transcript >Ophio5|1835
ATGGCCCTCGCCTCGAAGCCCGAGTCGCCGGTCAAGGCAAAGAAGACGTATGGCGGTAACAGTGCTTATCACAAC
TTCCATAATGACTTCGTTCATGTCGCCGATCTCAATGAGCGCCGTCGTCTCGCCCTGGCCGAGGTCGACCGCGCG
CCCTTTGGCTGGTATCATGTGCGCGCCTGCGCCGTTGCCGGCGTTGGCTTCTTCACCGACTCGTACGACATCTTC
ACGGCCTCTCTCCTGACCATCATGCTCGGCATCGTCTACTTCCCGGGCATCGGAGTCATGCCCACCACCTCGGAT
GATGCCATTAAGCTCGCCACCTCGGCCGGCACCGTCGTGGGCCAGCTCGGCTTCGGCTGCCTTGCTGACCTTGTC
GGCCGCAGGCGCATGTATGGCCTTGAACTCTTCGTCATCATCTTCGCCACCCTCGGTCAAGCCTTGACCAGCGGC
TCTCCCGCGTGCGACATCATTGGCCTCGTCATCTTCTGGCGCGTCATCATGGGCATCGGCATCGGCGGCGACTAT
CCGCTGTCGTCCATTATTACCTCAGAGTTCGCAACTACCAAGTGGAGGGGCGCCATGATGGCCGCCGTCTTCGCC
ATGCAGGGGCTCGGTCAGCTGGGCGCCGCCATGGTCATGCTCTTCGTCACTCTCGGCTTCCGTTCTCAACTCGAG
GCGGCGCCCGACATTGCCCACTGTGACGGCGAATGTCGCGTCTCGGTCGACAGGATGTGGAGGACCCTCATCGGC
TTCGGCGCCGTCCCCGCTTGCATTGCCCTGTACTTCCGCCTCACCATCCCCGAAACACCGCGCTACACCTTCGAC
GCGGCCAGAGACGTTGAAAAGGCAGAGGATGACGTTGCCGCCTACCTGAACGGCAAGCCTTCGGGCGAGCACGAT
CCCGTGTCCCGCGTCGCCACGCAGGCCGCCGCTGTCGAGAGCCTCGACGTCCCCAAGGCCAGCTGGGCCGACTTC
TTGCACCACTATTCCCAGATGAAGAATTTGAAGCTCCTCCTCGGCACCGCCGGCTCGTGGTTTTGCCTCGACGTC
GCCTTCTACGGCCTGTCCCTCAACAACGGCACCATCCTCAGCGTCATCGGCTACTCGACCAAGAACGCACACAAC
GTCTACCAGTTCCTCTACAACACCGCCGTCGGCAATCTCGTCATCGTCCTCGCCGGCGCCGTTCCGGGCTACTGG
GTGTCGGTGGCCACCATCGACACCCTGGGCCGCAAGAAGATCCAGATGGGTGGCTTCATCATCCTCGTCGCCATC
CTCGTCTCCATGGGCTTCGCCTATCATAGTCTCTCTCCGGAGGGCCTGCTGGGTCTCTACGTCGTCGCCCAGTTC
TTCTTCAACTTTGGCCCCAACACCACCACCTTCATCGTCCCTGGAGAGGTCTTCCCCACCCGCTATCGGTCCACC
TCGCACGGCATCTCCGCCGCCTCGGGCAAGATCGGCTCCATCATCGGCCAGGCCGCCATCGCCACGCTCCGCACC
CGCGGCGCCACAAAGGACAACCCTTCGCCCTGGATGAACCACGTACTCCAGATCTACGCCCTCTTCATGCTCCTC
GGTTGCTTCACCACGCTGCTGATCCCCGAGACGGCGCGAAAAACGCTCGAGGAGCTCAGCGGCGAGGACGACTAT
GCCACAAGAACGCCCGCCGCCGTGGACCAGACGAATACAACCAGGGCCAATTCGCCCGCAAAGGAACAGGATAGT
CCTCACTCACCTAATGGAGTAGAGTGA
Gene >Ophio5|1835
ATGGCCCTCGCCTCGAAGCCCGAGTCGCCGGTCAAGGCAAAGAAGACGTATGGCGGTAACAGTGCTTATCACAAC
TTCCATAATGACTTCGTTCATGTCGCCGATCTCAATGAGCGCCGTCGTCTCGCCCTGGCCGAGGTCGACCGCGCG
CCCTTTGGCTGGTATCATGTGCGCGCCTGCGCCGTTGCCGGCGTTGGCTTCTTCACCGACTCGTACGACATCTTC
ACGGCCTCTCTCCTGACCATCATGCTCGGCATCGTCTACTTCCCGGGCATCGGAGTCATGCCCACCACCTCGGAT
GATGCCATTAAGCTCGCCACCTCGGCCGGCACCGTCGTGGGCCAGCTCGGCTTCGGCTGCCTTGCTGACCTTGTC
GGCCGCAGGCGCATGTATGGCCTTGAACTCTTCGTCATCATCTTCGCCACCCTCGGTCAAGCCTTGACCAGCGGC
TCTCCCGCGTGCGACATCATTGGCCTCGTCATCTTCTGGCGCGTCATCATGGGCATCGGCATCGGCGGCGACTAT
CCGCTGTCGTCCATTATTACCTCAGAGTTCGTTTATTTTTTTTTATCCCTCAAAACTTTTGTATGTAGCCCCTTA
GCCGTACTAACAAGCCGGCCGCAGGTTCGCAACTACCAAGTGGAGGGGCGCCATGATGGCCGCCGTCTTCGCCAT
GCAGGGGCTCGGTCAGCTGGGCGCCGCCATGGTCATGCTCTTCGTCACTCTCGGCTTCCGTTCTCAACTCGAGGC
GGCGCCCGACATTGCCCACTGTGACGGCGAATGTCGCGTCTCGGTCGACAGGATGTGGAGGACCCTCATCGGCTT
CGGCGCCGTCCCCGCTTGCATTGCCCTGTACTGTAAGTGTCCCCAATTTCTTCCCGGTCCGGCGCGGCCCGGTGA
CTAACGCCGTCAAGTCCGCCTCACCATCCCCGAAACACCGCGCTACACCTTCGACGCGGCCAGAGACGTTGAAAA
GGCAGAGGATGACGTTGCCGCCTACCTGAACGGCAAGCCTTCGGGCGAGCACGATCCCGTGTCCCGCGTCGCCAC
GCAGGCCGCCGCTGTCGAGAGCCTCGACGTCCCCAAGGCCAGCTGGGCCGACTTCTTGCACCACTATTCCCAGAT
GAAGAATTTGAAGCTCCTCCTCGGCACCGCCGGCTCGTGGTTTTGCCTCGACGTCGCCTTCTACGGCCTGTCCCT
CAACAACGGCACCATCCTCAGCGTCATCGGCTACTCGACCAAGAACGCACACAACGTCTACCAGTTCCTCTACAA
CACCGCCGTCGGCAATCTCGTCATCGTCCTCGCCGGCGCCGTTCCGGGCTACTGGGTGTCGGTGGCCACCATCGA
CACCCTGGGCCGCAAGAAGATCCAGATGGGTGGCTTCATCATCCTCGTCGCCATCCTCGTCTCCATGGGCTTCGC
CTATCATAGTCTCTCTCCGGAGGGCCTGCTGGGTCTCTACGTCGTCGCCCAGTTCTTCTTCAACTTTGGTCAGTC
TCCTCTTCCCCCCTCTTCACCCTCCTTTACCGACTACTGATGGACTATCAGGCCCCAACACCACCACCTTCATCG
TCCCTGGAGAGGTCTTCCCCACCCGCTATCGGTCCACCTCGCACGGCATCTCCGCCGCCTCGGGCAAGATCGGCT
CCATCATCGGCCAGGCCGCCATCGCCACGCTCCGCACCCGCGGCGCCACAAAGGACAACCCTTCGCCCTGGATGA
ACCACGTACTCCAGATCTACGCCCTCTTCATGCTCCTCGGTTGCTTCACCACGCTGCTGATCCCCGAGACGGCGC
GAAAAACGCTCGAGGAGCTCAGCGGCGAGGACGACTATGCCACAAGAACGCCCGCCGCCGTGGACCAGACGAATA
CAACCAGGGCCAATTCGCCCGCAAAGGAACAGGATAGTCCTCACTCACCTAATGGAGTAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail