Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1830
Gene name
Locationscaffold_17:42002..42815
Strand-
Gene length (bp)813
Transcript length (bp)612
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04145 Ctr Ctr copper transporter family 6.9E-34 43 182

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94722|CTR4_SCHPO Copper transport protein ctr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr4 PE=1 SV=1 36 182 3.0E-19
sp|Q06686|CTR3_YEAST Copper transport protein CTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR3 PE=1 SV=1 21 187 4.0E-18
sp|Q9P7F9|CTR5_SCHPO Copper transport protein ctr5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr5 PE=1 SV=1 37 202 7.0E-16
sp|P38865|CTR2_YEAST Copper transport protein CTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR2 PE=1 SV=1 4 202 6.0E-09

GO

GO Term Description Terminal node
GO:0005375 copper ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0035434 copper ion transmembrane transport Yes
GO:0000041 transition metal ion transport No
GO:0008150 biological_process No
GO:0098655 cation transmembrane transport No
GO:0031224 intrinsic component of membrane No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0098662 inorganic cation transmembrane transport No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0034220 ion transmembrane transport No
GO:0005215 transporter activity No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006825 copper ion transport No
GO:0030001 metal ion transport No
GO:0005575 cellular_component No
GO:0046873 metal ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0006812 cation transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 143 160 17
3 165 182 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1830
MDRLAALVKRHGGMDHHDGGMDHGGHDHSSMGHGGGSSCKFSMVFHSTTIDSCFLSDKWHITSTAMFAGSCIGVF
LLAVTLELIRRLVKEYDRHLLRQHLAHFPPMAEHNKTVSERNKEAATSATAVSPSSFRPTVYQQAARAFLQLMLI
TCAWTLMLLVMYFNVYLILSILLGFYVGAFVFQWEKMPINSRPTASDSALCCS
Coding >Ophio5|1830
ATGGATCGGCTCGCGGCTCTCGTAAAGCGCCACGGAGGCATGGATCACCACGACGGCGGCATGGACCACGGCGGC
CATGACCACAGCAGCATGGGTCACGGCGGTGGCAGCTCCTGCAAATTCTCAATGGTCTTTCACTCCACCACCATC
GACTCCTGCTTCCTGTCCGACAAATGGCACATCACCTCGACGGCCATGTTCGCCGGCTCCTGCATCGGCGTCTTC
CTCCTCGCCGTCACCCTCGAGCTCATCCGCCGTCTGGTAAAGGAGTACGACCGCCATCTCCTGCGCCAGCACCTC
GCCCATTTCCCACCCATGGCTGAGCACAACAAGACCGTCAGTGAGAGAAACAAGGAGGCGGCGACCTCTGCCACG
GCCGTCTCCCCTAGCTCTTTCCGCCCGACCGTCTATCAGCAGGCGGCTCGGGCCTTTTTGCAGCTGATGCTCATC
ACCTGCGCCTGGACGCTGATGCTGCTTGTCATGTACTTCAACGTCTACCTCATCTTGTCCATTCTCCTCGGCTTC
TACGTCGGAGCTTTTGTCTTCCAGTGGGAGAAGATGCCCATCAATAGTCGGCCGACGGCTTCCGACTCGGCCCTT
TGCTGCAGC
Transcript >Ophio5|1830
ATGGATCGGCTCGCGGCTCTCGTAAAGCGCCACGGAGGCATGGATCACCACGACGGCGGCATGGACCACGGCGGC
CATGACCACAGCAGCATGGGTCACGGCGGTGGCAGCTCCTGCAAATTCTCAATGGTCTTTCACTCCACCACCATC
GACTCCTGCTTCCTGTCCGACAAATGGCACATCACCTCGACGGCCATGTTCGCCGGCTCCTGCATCGGCGTCTTC
CTCCTCGCCGTCACCCTCGAGCTCATCCGCCGTCTGGTAAAGGAGTACGACCGCCATCTCCTGCGCCAGCACCTC
GCCCATTTCCCACCCATGGCTGAGCACAACAAGACCGTCAGTGAGAGAAACAAGGAGGCGGCGACCTCTGCCACG
GCCGTCTCCCCTAGCTCTTTCCGCCCGACCGTCTATCAGCAGGCGGCTCGGGCCTTTTTGCAGCTGATGCTCATC
ACCTGCGCCTGGACGCTGATGCTGCTTGTCATGTACTTCAACGTCTACCTCATCTTGTCCATTCTCCTCGGCTTC
TACGTCGGAGCTTTTGTCTTCCAGTGGGAGAAGATGCCCATCAATAGTCGGCCGACGGCTTCCGACTCGGCCCTT
TGCTGCAGCTAG
Gene >Ophio5|1830
ATGGATCGGCTCGCGGCTCTCGTAAAGCGCCACGGAGGCATGGATCACCACGACGGCGGCATGGACCACGGCGGC
CATGACCACAGCAGCATGGGTCACGGCGGTGGCAGCTCCTGCAAATTCTCAGTATGGCCAGCCCCTTTTCAGTCC
TCCCAGAGAGAAGCACACTGCTGAACGAAACGAAACGCCTCTAGATGGTCTTTCACTCCACCACCATCGACTCCT
GCTTCCTGTCCGACAAATGGCACATCACCTCGACGGCCATGTTCGCCGGCTCCTGCATCGGCGTCTTCCTCCTCG
CCGTCACCCTCGAGCTCATCCGCCGTCTGGTAAAGGAGTACGACCGCCATCTCCTGCGCCAGCACCTCGCCCATT
TCCCACCCATGGCTGAGCACAACAAGACCGTCAGTGAGAGAAACAAGGAGGCGGCGACCTCTGCCACGGCCGTCT
CCCCTAGCTCTTTCCGCCCGACCGTCTATCAGCAGGCGGCTCGGGCCTTTTTGCAGCTGATGCTCATCACCTGCG
CCTGGACGCTGATGCTGGTGAGGTGCTCTGGCAAAAAAAACAACAACCCTATTTTGAACCCTTGGTACTGACCAC
CGTTTGCCCATCTAGCTTGTCATGTACTTCAACGTCTACCTCATCTTGTCCATTCTCCTCGGCTTCTACGTCGGA
GCTTTTGTCTTCCAGTGGGAGAAGATGCCCATCAAGTACGTCGTTGCCTCGTTGTGAGCGGTGACAGGCCTGGCT
GACGTTGTTTTCGCCTGAAGTAGTCGGCCGACGGCTTCCGACTCGGCCCTTTGCTGCAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail