Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1820
Gene name
Locationscaffold_17:19760..20841
Strand+
Gene length (bp)1081
Transcript length (bp)948
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.8E-12 34 252
PF00083 Sugar_tr Sugar (and other) transporter 8.9E-10 21 293

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 21 298 3.0E-30
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 21 309 1.0E-26
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 21 263 2.0E-21
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 19 305 3.0E-18
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 21 306 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 21 298 3.0E-30
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 21 309 1.0E-26
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 21 263 2.0E-21
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 19 305 3.0E-18
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 21 306 4.0E-18
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 21 263 2.0E-15
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 21 288 3.0E-14
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 22 199 1.0E-13
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 27 188 2.0E-13
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 32 287 2.0E-11
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 23 228 5.0E-11
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 4 192 6.0E-11
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 31 222 8.0E-11
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 7 156 1.0E-09
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 21 263 6.0E-08
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 32 112 7.0E-08
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 22 163 2.0E-06
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 22 113 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19
2 44 63 19
3 111 133 22
4 146 168 22
5 175 197 22
6 207 229 22
7 236 258 22
8 271 293 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1820
MVGRRSRAFCVHPVVASRAKFGGAVAYTIGHMNGVLGLAGWRWLFIIEGIPSCFSAIFVFFFLPDYPESASWLSG
SEKALAAKRLLHEGSKSCHKTASWTDAKATLMDWRLYVHYALYFAVNSPFAGLSLFAPSLTSGLGFRDLDAQLMT
VPSWAVAYVCQIAVAYSADRFNARGAHMAGAALVGAAGFAASAALPATAYKARYGALFMATSGTFASVPPMLGWL
TSNLFSTASTGLAVAINVSVGGGLGQIPGVWIYKPAEASLGYPTGHWTNAAFLLLVAVMALALRFFYVGENGRLA
AEAERRGVQTRLYKL
Coding >Ophio5|1820
ATGGTCGGGCGGAGAAGCAGAGCATTCTGTGTACATCCAGTGGTTGCATCGCGCGCCAAATTTGGCGGCGCCGTT
GCCTACACCATCGGTCACATGAACGGCGTTCTGGGCCTCGCCGGCTGGCGGTGGCTCTTTATCATTGAAGGCATC
CCGTCGTGCTTCTCGGCCATCTTTGTATTTTTCTTCCTTCCCGACTATCCAGAGAGCGCCAGCTGGCTTTCCGGG
TCGGAAAAGGCCCTGGCGGCGAAGCGTTTGCTCCACGAGGGCAGCAAGAGCTGTCATAAGACGGCGAGCTGGACG
GATGCAAAGGCGACACTGATGGACTGGCGTCTGTACGTCCACTACGCTCTCTATTTCGCCGTCAACTCGCCCTTT
GCTGGCCTGAGTCTATTTGCCCCGTCGCTTACCTCTGGGCTCGGGTTCCGGGACCTCGACGCCCAGTTGATGACG
GTTCCGTCGTGGGCCGTGGCGTATGTCTGTCAGATCGCCGTCGCTTATTCGGCCGACCGGTTTAATGCCCGAGGC
GCGCACATGGCGGGCGCGGCGCTGGTCGGCGCCGCCGGCTTCGCGGCTTCGGCTGCGCTGCCGGCGACGGCGTAC
AAGGCGCGGTACGGCGCCCTATTCATGGCGACGTCCGGCACCTTTGCCAGCGTCCCGCCGATGCTTGGATGGCTT
ACGTCGAACCTATTCAGCACAGCGTCGACCGGACTGGCCGTTGCCATCAACGTGAGTGTCGGTGGTGGCCTGGGT
CAGATCCCGGGCGTATGGATCTACAAGCCCGCCGAGGCCTCGCTGGGCTATCCGACGGGACACTGGACCAACGCA
GCCTTTCTGCTACTCGTTGCGGTCATGGCACTCGCCCTCAGGTTCTTTTACGTAGGCGAGAATGGGAGGCTGGCG
GCCGAGGCGGAGAGACGAGGGGTGCAGACAAGACTATACAAACTG
Transcript >Ophio5|1820
ATGGTCGGGCGGAGAAGCAGAGCATTCTGTGTACATCCAGTGGTTGCATCGCGCGCCAAATTTGGCGGCGCCGTT
GCCTACACCATCGGTCACATGAACGGCGTTCTGGGCCTCGCCGGCTGGCGGTGGCTCTTTATCATTGAAGGCATC
CCGTCGTGCTTCTCGGCCATCTTTGTATTTTTCTTCCTTCCCGACTATCCAGAGAGCGCCAGCTGGCTTTCCGGG
TCGGAAAAGGCCCTGGCGGCGAAGCGTTTGCTCCACGAGGGCAGCAAGAGCTGTCATAAGACGGCGAGCTGGACG
GATGCAAAGGCGACACTGATGGACTGGCGTCTGTACGTCCACTACGCTCTCTATTTCGCCGTCAACTCGCCCTTT
GCTGGCCTGAGTCTATTTGCCCCGTCGCTTACCTCTGGGCTCGGGTTCCGGGACCTCGACGCCCAGTTGATGACG
GTTCCGTCGTGGGCCGTGGCGTATGTCTGTCAGATCGCCGTCGCTTATTCGGCCGACCGGTTTAATGCCCGAGGC
GCGCACATGGCGGGCGCGGCGCTGGTCGGCGCCGCCGGCTTCGCGGCTTCGGCTGCGCTGCCGGCGACGGCGTAC
AAGGCGCGGTACGGCGCCCTATTCATGGCGACGTCCGGCACCTTTGCCAGCGTCCCGCCGATGCTTGGATGGCTT
ACGTCGAACCTATTCAGCACAGCGTCGACCGGACTGGCCGTTGCCATCAACGTGAGTGTCGGTGGTGGCCTGGGT
CAGATCCCGGGCGTATGGATCTACAAGCCCGCCGAGGCCTCGCTGGGCTATCCGACGGGACACTGGACCAACGCA
GCCTTTCTGCTACTCGTTGCGGTCATGGCACTCGCCCTCAGGTTCTTTTACGTAGGCGAGAATGGGAGGCTGGCG
GCCGAGGCGGAGAGACGAGGGGTGCAGACAAGACTATACAAACTGTGA
Gene >Ophio5|1820
ATGGTCGGGCGGAGAAGCAGAGCATTCTGTGTACATCCAGTGGTTGCATCGCGCGCCAAAGTAAGGACGTCTCTT
TCAGGGGGTGAGCGAGTTGACGAGCTTGCAAGCATGAAACAAAACGGCATCTGACGTCTTTGGCAGTTTGGCGGC
GCCGTTGCCTACACCATCGGTCACATGAACGGCGTTCTGGGCCTCGCCGGCTGGCGGTGGCTCTTTATCATTGAA
GGCATCCCGTCGTGCTTCTCGGCCATCTTTGTATTTTTCTTCCTTCCCGACTATCCAGAGAGCGCCAGCTGGCTT
TCCGGGTCGGAAAAGGCCCTGGCGGCGAAGCGTTTGCTCCACGAGGGCAGCAAGAGCTGTCATAAGACGGCGAGC
TGGACGGATGCAAAGGCGACACTGATGGACTGGCGTCTGTACGTCCACTACGCTCTCTATTTCGCCGTCAACTCG
CCCTTTGCTGGCCTGAGTCTATTTGCCCCGTCGCTTACCTCTGGGCTCGGGTTCCGGGACCTCGACGCCCAGTTG
ATGACGGTTCCGTCGTGGGCCGTGGCGTATGGTTAGTTGCCGTCTGTGACGTGACCGTGGCGGGCTCCTGATGGG
CTCCATAGTCTGTCAGATCGCCGTCGCTTATTCGGCCGACCGGTTTAATGCCCGAGGCGCGCACATGGCGGGCGC
GGCGCTGGTCGGCGCCGCCGGCTTCGCGGCTTCGGCTGCGCTGCCGGCGACGGCGTACAAGGCGCGGTACGGCGC
CCTATTCATGGCGACGTCCGGCACCTTTGCCAGCGTCCCGCCGATGCTTGGATGGCTTACGTCGAACCTATTCAG
CACAGCGTCGACCGGACTGGCCGTTGCCATCAACGTGAGTGTCGGTGGTGGCCTGGGTCAGATCCCGGGCGTATG
GATCTACAAGCCCGCCGAGGCCTCGCTGGGCTATCCGACGGGACACTGGACCAACGCAGCCTTTCTGCTACTCGT
TGCGGTCATGGCACTCGCCCTCAGGTTCTTTTACGTAGGCGAGAATGGGAGGCTGGCGGCCGAGGCGGAGAGACG
AGGGGTGCAGACAAGACTATACAAACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail