Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1817
Gene name
Locationscaffold_17:17715..18587
Strand+
Gene length (bp)872
Transcript length (bp)819
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 1.9E-48 46 254

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 37 56 19
2 63 85 22
3 95 112 17
4 125 147 22
5 157 176 19
6 215 232 17
7 237 259 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 122.54 67.58 177.50
CcL In ants, during behavior modification 93.76 49.95 137.57
CcD In ants, recently dead 123.46 68.68 178.23

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.268603 no
SC16a CcD 0.979871 no
CcL CcD 0.244634 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1817
MTGSDDFPAGEGSPLLGRREPPTYMASRLASRLTDDVSRSWADVVLLLCYVVTGLLDSASTQVWGAFVSMQTGNT
VYVGLGLASLVSPPASPRLYRSGVSLVSFCLGSFLFSRFHRRFSPRRRWVLCASFAVQAALIVFAALIIATAPPA
RDDAVDWTVLLPLALVAFQSCAQAVASRALRYNALTSVVLTSIYCDLFSDQDLLALRNVERNRRAAAPLLLLLGA
VAGGLLAHSSLGISGALWCAAAIKFCMVIVWFSWPPEPEVNVDETPS
Coding >Ophio5|1817
ATGACCGGCTCCGATGATTTCCCGGCCGGCGAGGGCTCGCCGTTGCTCGGCCGGCGAGAGCCTCCCACGTACATG
GCATCACGACTGGCCAGCCGGCTAACCGACGACGTGTCGCGCTCGTGGGCAGACGTCGTTCTTCTGCTGTGCTAC
GTCGTCACCGGTCTTCTCGACAGCGCATCGACGCAGGTTTGGGGCGCCTTCGTCTCCATGCAGACTGGTAACACC
GTTTACGTCGGCCTTGGCCTCGCCTCGCTCGTCTCACCCCCGGCTTCTCCACGGCTATACCGCTCGGGCGTCTCC
CTCGTCTCCTTTTGCCTTGGGTCCTTTCTTTTCTCCCGCTTCCATCGCCGCTTCTCCCCTCGTCGTCGTTGGGTG
CTCTGTGCCTCCTTCGCCGTCCAGGCCGCTCTCATCGTCTTCGCCGCCCTCATAATCGCCACAGCGCCGCCGGCT
CGCGACGACGCGGTCGACTGGACCGTCCTGCTGCCCCTCGCCCTCGTCGCATTCCAGAGCTGTGCCCAGGCCGTG
GCCAGTCGCGCACTTCGCTATAACGCCCTGACCAGCGTCGTCCTCACCAGCATCTACTGCGACCTGTTCTCCGAC
CAGGACCTATTGGCCTTACGCAACGTCGAGCGGAACCGCCGCGCTGCCGCTCCGCTACTGCTGCTTCTCGGTGCC
GTCGCAGGAGGCCTATTGGCTCACAGCTCCCTCGGCATCAGCGGCGCCCTGTGGTGCGCCGCCGCCATCAAGTTT
TGCATGGTCATCGTCTGGTTCTCGTGGCCCCCGGAGCCTGAGGTCAACGTCGACGAAACGCCATCA
Transcript >Ophio5|1817
ATGACCGGCTCCGATGATTTCCCGGCCGGCGAGGGCTCGCCGTTGCTCGGCCGGCGAGAGCCTCCCACGTACATG
GCATCACGACTGGCCAGCCGGCTAACCGACGACGTGTCGCGCTCGTGGGCAGACGTCGTTCTTCTGCTGTGCTAC
GTCGTCACCGGTCTTCTCGACAGCGCATCGACGCAGGTTTGGGGCGCCTTCGTCTCCATGCAGACTGGTAACACC
GTTTACGTCGGCCTTGGCCTCGCCTCGCTCGTCTCACCCCCGGCTTCTCCACGGCTATACCGCTCGGGCGTCTCC
CTCGTCTCCTTTTGCCTTGGGTCCTTTCTTTTCTCCCGCTTCCATCGCCGCTTCTCCCCTCGTCGTCGTTGGGTG
CTCTGTGCCTCCTTCGCCGTCCAGGCCGCTCTCATCGTCTTCGCCGCCCTCATAATCGCCACAGCGCCGCCGGCT
CGCGACGACGCGGTCGACTGGACCGTCCTGCTGCCCCTCGCCCTCGTCGCATTCCAGAGCTGTGCCCAGGCCGTG
GCCAGTCGCGCACTTCGCTATAACGCCCTGACCAGCGTCGTCCTCACCAGCATCTACTGCGACCTGTTCTCCGAC
CAGGACCTATTGGCCTTACGCAACGTCGAGCGGAACCGCCGCGCTGCCGCTCCGCTACTGCTGCTTCTCGGTGCC
GTCGCAGGAGGCCTATTGGCTCACAGCTCCCTCGGCATCAGCGGCGCCCTGTGGTGCGCCGCCGCCATCAAGTTT
TGCATGGTCATCGTCTGGTTCTCGTGGCCCCCGGAGCCTGAGGTCAACGTCGACGAAACGCCATCATGA
Gene >Ophio5|1817
ATGACCGGCTCCGATGATTTCCCGGCCGGCGAGGGCTCGCCGTTGCTCGGCCGGCGAGAGCCTCCCACGTACATG
GCATCACGACTGGCCAGCCGGCTAACCGACGACGTGTCGCGCTCGTGGGCAGACGTCGTTCTTCTGCTGTGCTAC
GTCGTCACCGGTCTTCTCGACAGCGCATCGACGCAGGTTTGGGGCGCCTTCGTCTCCATGCAGACTGGTTGCGTC
TTCCGCCTCATCCCGACGCCTCTTCGGGTCTGACACGAGACGCAGGTAACACCGTTTACGTCGGCCTTGGCCTCG
CCTCGCTCGTCTCACCCCCGGCTTCTCCACGGCTATACCGCTCGGGCGTCTCCCTCGTCTCCTTTTGCCTTGGGT
CCTTTCTTTTCTCCCGCTTCCATCGCCGCTTCTCCCCTCGTCGTCGTTGGGTGCTCTGTGCCTCCTTCGCCGTCC
AGGCCGCTCTCATCGTCTTCGCCGCCCTCATAATCGCCACAGCGCCGCCGGCTCGCGACGACGCGGTCGACTGGA
CCGTCCTGCTGCCCCTCGCCCTCGTCGCATTCCAGAGCTGTGCCCAGGCCGTGGCCAGTCGCGCACTTCGCTATA
ACGCCCTGACCAGCGTCGTCCTCACCAGCATCTACTGCGACCTGTTCTCCGACCAGGACCTATTGGCCTTACGCA
ACGTCGAGCGGAACCGCCGCGCTGCCGCTCCGCTACTGCTGCTTCTCGGTGCCGTCGCAGGAGGCCTATTGGCTC
ACAGCTCCCTCGGCATCAGCGGCGCCCTGTGGTGCGCCGCCGCCATCAAGTTTTGCATGGTCATCGTCTGGTTCT
CGTGGCCCCCGGAGCCTGAGGTCAACGTCGACGAAACGCCATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail