Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1795
Gene name
Locationscaffold_169:5601..7665
Strand-
Gene length (bp)2064
Transcript length (bp)2064
Coding sequence length (bp)2061
Protein length (aa) 687

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1315 0.0702 0.9039 0.1317 0.2079 0.0237 0.2184 0.3056 0.1098 0.0059

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999739

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup513
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2042
Ophiocordyceps australis 1348a (Ghana) OphauG2|2043
Ophiocordyceps australis map64 (Brazil) OphauB2|330
Ophiocordyceps camponoti-floridani Ophcf2|03497
Ophiocordyceps camponoti-rufipedis Ophun1|1443
Ophiocordyceps kimflemingae Ophio5|1795 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2153
Ophiocordyceps subramaniannii Hirsu2|2505

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1795
MHFLPLITFPLAALTAAVQAQRTPADEASEACKSISQAMKETPRPSTTNINKTTDTGPVSQRSRLLLGRTVQDCL
ESIPFDRERTAAFIPELKKYVEFQSTLEILKNPPASWPFEAVDVLGRLDGLGTDFKSQYEFDLAIDNLAVSAHDS
HFNVLGCSLRIFSFQRDHPGIIAVSKDGLALPEIYSVTDAAKLANDQADDVSPIETINGQDVLGYLEKIAINSSS
QSPDSQWNELFANPEWLASPAVPNRGRFVNNRRRWPGTDNTTITFKNGSSIDASTLARLNGKKKFNSTTPAEVFE
RYCVPKGPPPPPSTKEGQDPDPEGFPKPFARDPLNQMMGYNLDDETAVMKVASFGGHEKAKDYAMLIKNLTDEII
DTAKASGRTKMIIDVSGNPGGEIQRYRTLFKAFFPDLFPFEPRRLRRSDQVEAMVQAFSTLNQSASERTPLSAAH
KALTTPDEKIRYNTSEEFLGDTEMEGQLVTSPFTFLSVRAPANPPVRGFGDGAKNGLTIDERPFKVQDLLIIGNG
FCHSSCAGFVNLMANQGGVKTMTFGGRHQLKDMDIIGGTRGGQIAFFPVLSSLSEAASKILRNTTSEVSLSSSER
EKAADSLPKPLQNLTLNTFGTVNFQSMYASDGTDGSTLQFQNQPSDCRRFFTAQNILDPKSIWKDAQEAFWGGGQ
CFGPGGNSTDQA
Coding >Ophio5|1795
ATGCATTTCCTGCCGTTGATTACCTTTCCTCTGGCGGCCCTGACGGCCGCTGTTCAGGCTCAGCGTACTCCTGCG
GATGAGGCAAGTGAAGCCTGCAAAAGCATCAGCCAGGCCATGAAAGAGACGCCGCGGCCATCAACAACCAACATC
AATAAGACAACCGACACTGGGCCGGTCAGCCAAAGGTCCCGGTTACTCCTCGGCCGGACCGTCCAGGACTGTCTG
GAGTCGATTCCCTTCGATCGCGAACGCACCGCGGCCTTTATTCCCGAGCTGAAGAAGTACGTCGAGTTCCAATCA
ACGCTGGAGATCCTTAAAAACCCCCCGGCTTCGTGGCCCTTTGAGGCAGTCGACGTGCTTGGAAGGCTGGATGGT
CTCGGGACCGATTTCAAAAGCCAGTACGAGTTTGACCTCGCCATCGACAATCTCGCCGTCTCAGCCCACGACTCT
CACTTCAATGTCTTGGGCTGCTCGCTGCGCATCTTTAGCTTTCAGCGGGATCATCCCGGCATCATCGCCGTATCA
AAGGATGGGCTGGCCCTCCCGGAGATATACTCGGTTACCGACGCCGCTAAGCTTGCAAATGATCAAGCAGACGAC
GTCTCCCCAATAGAGACCATCAACGGCCAGGACGTGCTCGGATATCTTGAGAAAATCGCCATCAATTCGTCCTCG
CAAAGTCCGGATTCTCAATGGAACGAGCTCTTCGCCAACCCAGAATGGTTGGCAAGCCCAGCCGTCCCCAATAGG
GGGAGATTCGTCAACAACCGCCGGCGGTGGCCCGGTACGGATAACACGACAATCACGTTCAAAAACGGTTCTTCC
ATCGACGCCTCGACACTCGCCCGCCTCAACGGCAAGAAGAAATTCAATAGCACGACGCCTGCAGAAGTCTTTGAA
AGATACTGCGTGCCAAAGGGGCCTCCGCCTCCGCCGTCGACAAAGGAAGGGCAAGACCCAGACCCTGAAGGGTTT
CCGAAACCCTTCGCTCGTGATCCGCTCAATCAAATGATGGGCTACAACCTTGACGACGAGACGGCGGTTATGAAG
GTAGCCTCGTTTGGTGGCCATGAAAAGGCCAAGGATTATGCCATGCTCATTAAAAACCTGACAGACGAGATTATC
GACACTGCCAAAGCATCGGGTCGAACCAAGATGATTATCGATGTATCCGGAAATCCTGGCGGTGAAATACAACGA
TACAGGACCCTCTTTAAGGCCTTCTTCCCAGACCTTTTCCCCTTTGAGCCCCGACGTCTTCGACGCAGCGACCAG
GTGGAAGCGATGGTGCAGGCTTTCTCTACTCTCAACCAGAGCGCGTCGGAGAGAACCCCTCTCAGCGCGGCACAT
AAAGCTCTCACCACTCCCGATGAGAAGATAAGATACAACACGTCTGAAGAGTTCCTTGGCGACACTGAAATGGAA
GGACAACTCGTCACCTCACCATTCACCTTCCTTTCCGTCCGAGCCCCAGCCAACCCACCAGTTCGGGGCTTTGGA
GACGGAGCCAAGAACGGTTTAACCATCGACGAGCGACCATTCAAGGTCCAGGATTTACTTATCATAGGCAACGGC
TTCTGCCACTCCTCCTGCGCCGGCTTTGTAAACCTCATGGCCAACCAGGGAGGGGTGAAGACAATGACATTCGGC
GGTCGTCATCAGCTCAAAGATATGGATATCATAGGCGGAACTCGCGGCGGTCAGATCGCCTTCTTTCCTGTTCTC
TCGAGTCTTTCAGAGGCGGCAAGTAAGATACTACGGAACACGACATCAGAAGTGTCTCTCAGCTCCTCAGAACGG
GAAAAGGCAGCGGACTCGCTACCGAAACCGCTTCAGAATTTAACCTTGAACACTTTTGGCACCGTCAACTTCCAG
AGCATGTATGCATCGGATGGAACAGATGGCTCGACGCTGCAGTTCCAGAACCAGCCCTCCGACTGTCGCCGTTTC
TTTACGGCGCAAAACATTCTTGACCCCAAGTCTATTTGGAAAGACGCCCAGGAGGCGTTCTGGGGTGGCGGTCAG
TGTTTTGGCCCGGGGGGAAACAGCACAGACCAGGCG
Transcript >Ophio5|1795
ATGCATTTCCTGCCGTTGATTACCTTTCCTCTGGCGGCCCTGACGGCCGCTGTTCAGGCTCAGCGTACTCCTGCG
GATGAGGCAAGTGAAGCCTGCAAAAGCATCAGCCAGGCCATGAAAGAGACGCCGCGGCCATCAACAACCAACATC
AATAAGACAACCGACACTGGGCCGGTCAGCCAAAGGTCCCGGTTACTCCTCGGCCGGACCGTCCAGGACTGTCTG
GAGTCGATTCCCTTCGATCGCGAACGCACCGCGGCCTTTATTCCCGAGCTGAAGAAGTACGTCGAGTTCCAATCA
ACGCTGGAGATCCTTAAAAACCCCCCGGCTTCGTGGCCCTTTGAGGCAGTCGACGTGCTTGGAAGGCTGGATGGT
CTCGGGACCGATTTCAAAAGCCAGTACGAGTTTGACCTCGCCATCGACAATCTCGCCGTCTCAGCCCACGACTCT
CACTTCAATGTCTTGGGCTGCTCGCTGCGCATCTTTAGCTTTCAGCGGGATCATCCCGGCATCATCGCCGTATCA
AAGGATGGGCTGGCCCTCCCGGAGATATACTCGGTTACCGACGCCGCTAAGCTTGCAAATGATCAAGCAGACGAC
GTCTCCCCAATAGAGACCATCAACGGCCAGGACGTGCTCGGATATCTTGAGAAAATCGCCATCAATTCGTCCTCG
CAAAGTCCGGATTCTCAATGGAACGAGCTCTTCGCCAACCCAGAATGGTTGGCAAGCCCAGCCGTCCCCAATAGG
GGGAGATTCGTCAACAACCGCCGGCGGTGGCCCGGTACGGATAACACGACAATCACGTTCAAAAACGGTTCTTCC
ATCGACGCCTCGACACTCGCCCGCCTCAACGGCAAGAAGAAATTCAATAGCACGACGCCTGCAGAAGTCTTTGAA
AGATACTGCGTGCCAAAGGGGCCTCCGCCTCCGCCGTCGACAAAGGAAGGGCAAGACCCAGACCCTGAAGGGTTT
CCGAAACCCTTCGCTCGTGATCCGCTCAATCAAATGATGGGCTACAACCTTGACGACGAGACGGCGGTTATGAAG
GTAGCCTCGTTTGGTGGCCATGAAAAGGCCAAGGATTATGCCATGCTCATTAAAAACCTGACAGACGAGATTATC
GACACTGCCAAAGCATCGGGTCGAACCAAGATGATTATCGATGTATCCGGAAATCCTGGCGGTGAAATACAACGA
TACAGGACCCTCTTTAAGGCCTTCTTCCCAGACCTTTTCCCCTTTGAGCCCCGACGTCTTCGACGCAGCGACCAG
GTGGAAGCGATGGTGCAGGCTTTCTCTACTCTCAACCAGAGCGCGTCGGAGAGAACCCCTCTCAGCGCGGCACAT
AAAGCTCTCACCACTCCCGATGAGAAGATAAGATACAACACGTCTGAAGAGTTCCTTGGCGACACTGAAATGGAA
GGACAACTCGTCACCTCACCATTCACCTTCCTTTCCGTCCGAGCCCCAGCCAACCCACCAGTTCGGGGCTTTGGA
GACGGAGCCAAGAACGGTTTAACCATCGACGAGCGACCATTCAAGGTCCAGGATTTACTTATCATAGGCAACGGC
TTCTGCCACTCCTCCTGCGCCGGCTTTGTAAACCTCATGGCCAACCAGGGAGGGGTGAAGACAATGACATTCGGC
GGTCGTCATCAGCTCAAAGATATGGATATCATAGGCGGAACTCGCGGCGGTCAGATCGCCTTCTTTCCTGTTCTC
TCGAGTCTTTCAGAGGCGGCAAGTAAGATACTACGGAACACGACATCAGAAGTGTCTCTCAGCTCCTCAGAACGG
GAAAAGGCAGCGGACTCGCTACCGAAACCGCTTCAGAATTTAACCTTGAACACTTTTGGCACCGTCAACTTCCAG
AGCATGTATGCATCGGATGGAACAGATGGCTCGACGCTGCAGTTCCAGAACCAGCCCTCCGACTGTCGCCGTTTC
TTTACGGCGCAAAACATTCTTGACCCCAAGTCTATTTGGAAAGACGCCCAGGAGGCGTTCTGGGGTGGCGGTCAG
TGTTTTGGCCCGGGGGGAAACAGCACAGACCAGGCGTAG
Gene >Ophio5|1795
ATGCATTTCCTGCCGTTGATTACCTTTCCTCTGGCGGCCCTGACGGCCGCTGTTCAGGCTCAGCGTACTCCTGCG
GATGAGGCAAGTGAAGCCTGCAAAAGCATCAGCCAGGCCATGAAAGAGACGCCGCGGCCATCAACAACCAACATC
AATAAGACAACCGACACTGGGCCGGTCAGCCAAAGGTCCCGGTTACTCCTCGGCCGGACCGTCCAGGACTGTCTG
GAGTCGATTCCCTTCGATCGCGAACGCACCGCGGCCTTTATTCCCGAGCTGAAGAAGTACGTCGAGTTCCAATCA
ACGCTGGAGATCCTTAAAAACCCCCCGGCTTCGTGGCCCTTTGAGGCAGTCGACGTGCTTGGAAGGCTGGATGGT
CTCGGGACCGATTTCAAAAGCCAGTACGAGTTTGACCTCGCCATCGACAATCTCGCCGTCTCAGCCCACGACTCT
CACTTCAATGTCTTGGGCTGCTCGCTGCGCATCTTTAGCTTTCAGCGGGATCATCCCGGCATCATCGCCGTATCA
AAGGATGGGCTGGCCCTCCCGGAGATATACTCGGTTACCGACGCCGCTAAGCTTGCAAATGATCAAGCAGACGAC
GTCTCCCCAATAGAGACCATCAACGGCCAGGACGTGCTCGGATATCTTGAGAAAATCGCCATCAATTCGTCCTCG
CAAAGTCCGGATTCTCAATGGAACGAGCTCTTCGCCAACCCAGAATGGTTGGCAAGCCCAGCCGTCCCCAATAGG
GGGAGATTCGTCAACAACCGCCGGCGGTGGCCCGGTACGGATAACACGACAATCACGTTCAAAAACGGTTCTTCC
ATCGACGCCTCGACACTCGCCCGCCTCAACGGCAAGAAGAAATTCAATAGCACGACGCCTGCAGAAGTCTTTGAA
AGATACTGCGTGCCAAAGGGGCCTCCGCCTCCGCCGTCGACAAAGGAAGGGCAAGACCCAGACCCTGAAGGGTTT
CCGAAACCCTTCGCTCGTGATCCGCTCAATCAAATGATGGGCTACAACCTTGACGACGAGACGGCGGTTATGAAG
GTAGCCTCGTTTGGTGGCCATGAAAAGGCCAAGGATTATGCCATGCTCATTAAAAACCTGACAGACGAGATTATC
GACACTGCCAAAGCATCGGGTCGAACCAAGATGATTATCGATGTATCCGGAAATCCTGGCGGTGAAATACAACGA
TACAGGACCCTCTTTAAGGCCTTCTTCCCAGACCTTTTCCCCTTTGAGCCCCGACGTCTTCGACGCAGCGACCAG
GTGGAAGCGATGGTGCAGGCTTTCTCTACTCTCAACCAGAGCGCGTCGGAGAGAACCCCTCTCAGCGCGGCACAT
AAAGCTCTCACCACTCCCGATGAGAAGATAAGATACAACACGTCTGAAGAGTTCCTTGGCGACACTGAAATGGAA
GGACAACTCGTCACCTCACCATTCACCTTCCTTTCCGTCCGAGCCCCAGCCAACCCACCAGTTCGGGGCTTTGGA
GACGGAGCCAAGAACGGTTTAACCATCGACGAGCGACCATTCAAGGTCCAGGATTTACTTATCATAGGCAACGGC
TTCTGCCACTCCTCCTGCGCCGGCTTTGTAAACCTCATGGCCAACCAGGGAGGGGTGAAGACAATGACATTCGGC
GGTCGTCATCAGCTCAAAGATATGGATATCATAGGCGGAACTCGCGGCGGTCAGATCGCCTTCTTTCCTGTTCTC
TCGAGTCTTTCAGAGGCGGCAAGTAAGATACTACGGAACACGACATCAGAAGTGTCTCTCAGCTCCTCAGAACGG
GAAAAGGCAGCGGACTCGCTACCGAAACCGCTTCAGAATTTAACCTTGAACACTTTTGGCACCGTCAACTTCCAG
AGCATGTATGCATCGGATGGAACAGATGGCTCGACGCTGCAGTTCCAGAACCAGCCCTCCGACTGTCGCCGTTTC
TTTACGGCGCAAAACATTCTTGACCCCAAGTCTATTTGGAAAGACGCCCAGGAGGCGTTCTGGGGTGGCGGTCAG
TGTTTTGGCCCGGGGGGAAACAGCACAGACCAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail