Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1793
Gene name
Locationscaffold_1689:96..660
Strand+
Gene length (bp)564
Transcript length (bp)564
Coding sequence length (bp)561
Protein length (aa) 187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12400 STIMATE STIMATE family 4.7E-30 9 97

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q3UF25|STIMA_MOUSE Store-operated calcium entry regulator STIMATE OS=Mus musculus GN=Tmem110 PE=2 SV=1 9 160 1.0E-08
sp|Q7TSW6|STIMA_RAT Store-operated calcium entry regulator STIMATE OS=Rattus norvegicus GN=Tmem110 PE=2 SV=1 9 160 2.0E-08
sp|Q86TL2|STIMA_HUMAN Store-operated calcium entry regulator STIMATE OS=Homo sapiens GN=TMEM110 PE=1 SV=1 9 137 3.0E-08
sp|Q12042|YP162_YEAST Vacuolar membrane protein YPL162C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL162C PE=1 SV=1 9 142 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 72 91 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1793
MTPLGKPAESILSGNYGSPPNAWWWLKQSIIYFGGLFGMKLCVLIIFIIFPWISKVGDWALGWTEGNERLQIAFV
MMIFPLVMNAMQYYIIDSFIKKKETDHERLSSEDPDELRRRCDESRRLRGHHGSDDDEDDDEATSHGRARSSGDD
DVYDPHIDGHAPTVIGSSSSRRTSRVKDGPTELFPKE
Coding >Ophio5|1793
ATGACACCCCTTGGCAAGCCGGCCGAGTCGATCCTCTCGGGAAACTATGGGAGCCCCCCCAACGCCTGGTGGTGG
CTCAAGCAGTCCATCATCTACTTTGGCGGCCTCTTCGGCATGAAGCTCTGCGTCCTCATCATCTTCATCATCTTC
CCCTGGATCTCAAAAGTCGGCGACTGGGCCCTCGGCTGGACAGAGGGCAACGAGCGGCTGCAAATCGCTTTTGTC
ATGATGATCTTCCCCCTTGTCATGAACGCCATGCAGTACTACATTATCGACTCCTTCATCAAGAAGAAGGAGACG
GATCACGAGCGCCTCTCGTCGGAAGATCCTGACGAGCTTCGCCGTCGGTGTGACGAGTCTAGGCGTCTGCGAGGT
CACCATGGCAGCGATGACGATGAAGATGACGACGAGGCCACATCCCACGGTCGTGCTCGCAGCAGCGGCGATGAT
GATGTTTACGACCCGCACATCGACGGTCATGCTCCCACTGTCATCGGCAGCAGTTCCAGCCGGCGCACCAGTCGT
GTCAAAGATGGTCCGACGGAGCTCTTTCCCAAGGAG
Transcript >Ophio5|1793
ATGACACCCCTTGGCAAGCCGGCCGAGTCGATCCTCTCGGGAAACTATGGGAGCCCCCCCAACGCCTGGTGGTGG
CTCAAGCAGTCCATCATCTACTTTGGCGGCCTCTTCGGCATGAAGCTCTGCGTCCTCATCATCTTCATCATCTTC
CCCTGGATCTCAAAAGTCGGCGACTGGGCCCTCGGCTGGACAGAGGGCAACGAGCGGCTGCAAATCGCTTTTGTC
ATGATGATCTTCCCCCTTGTCATGAACGCCATGCAGTACTACATTATCGACTCCTTCATCAAGAAGAAGGAGACG
GATCACGAGCGCCTCTCGTCGGAAGATCCTGACGAGCTTCGCCGTCGGTGTGACGAGTCTAGGCGTCTGCGAGGT
CACCATGGCAGCGATGACGATGAAGATGACGACGAGGCCACATCCCACGGTCGTGCTCGCAGCAGCGGCGATGAT
GATGTTTACGACCCGCACATCGACGGTCATGCTCCCACTGTCATCGGCAGCAGTTCCAGCCGGCGCACCAGTCGT
GTCAAAGATGGTCCGACGGAGCTCTTTCCCAAGGAGTAG
Gene >Ophio5|1793
ATGACACCCCTTGGCAAGCCGGCCGAGTCGATCCTCTCGGGAAACTATGGGAGCCCCCCCAACGCCTGGTGGTGG
CTCAAGCAGTCCATCATCTACTTTGGCGGCCTCTTCGGCATGAAGCTCTGCGTCCTCATCATCTTCATCATCTTC
CCCTGGATCTCAAAAGTCGGCGACTGGGCCCTCGGCTGGACAGAGGGCAACGAGCGGCTGCAAATCGCTTTTGTC
ATGATGATCTTCCCCCTTGTCATGAACGCCATGCAGTACTACATTATCGACTCCTTCATCAAGAAGAAGGAGACG
GATCACGAGCGCCTCTCGTCGGAAGATCCTGACGAGCTTCGCCGTCGGTGTGACGAGTCTAGGCGTCTGCGAGGT
CACCATGGCAGCGATGACGATGAAGATGACGACGAGGCCACATCCCACGGTCGTGCTCGCAGCAGCGGCGATGAT
GATGTTTACGACCCGCACATCGACGGTCATGCTCCCACTGTCATCGGCAGCAGTTCCAGCCGGCGCACCAGTCGT
GTCAAAGATGGTCCGACGGAGCTCTTTCCCAAGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail