Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1791
Gene name
Locationscaffold_1684:681..975
Strand-
Gene length (bp)294
Transcript length (bp)294
Coding sequence length (bp)291
Protein length (aa) 97

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1117 0.0915 0.758 0.4703 0.0611 0.0032 0.306 0.0762 0.114 0.0084

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup147
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7960
Ophiocordyceps australis map64 (Brazil) OphauB2|840
Ophiocordyceps camponoti-floridani Ophcf2|02656
Ophiocordyceps camponoti-floridani Ophcf2|06464
Ophiocordyceps camponoti-rufipedis Ophun1|4164
Ophiocordyceps camponoti-rufipedis Ophun1|6322
Ophiocordyceps kimflemingae Ophio5|1791 (this protein)
Ophiocordyceps kimflemingae Ophio5|2231
Ophiocordyceps kimflemingae Ophio5|447
Ophiocordyceps subramaniannii Hirsu2|10000
Ophiocordyceps subramaniannii Hirsu2|2074
Ophiocordyceps subramaniannii Hirsu2|389

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1791
MCAAEYTGCLAYNPFGSDGTLLEPTACSLGSAPTAAPGFGGSAPTDGVPNGGVSPDGLPSASASLTGSEAAPVVT
AGGERIRPAAMAVVVIAGLALL
Coding >Ophio5|1791
ATGTGTGCGGCCGAGTACACCGGCTGCCTTGCCTATAACCCTTTCGGTTCCGACGGAACGCTTCTCGAGCCTACG
GCCTGTTCTCTGGGCAGCGCGCCTACCGCTGCTCCGGGTTTCGGCGGCAGTGCTCCGACGGATGGCGTTCCGAAT
GGAGGTGTCTCCCCCGACGGCCTTCCCAGCGCCAGCGCCTCTCTGACGGGCAGCGAAGCGGCCCCAGTCGTCACG
GCGGGAGGGGAACGCATCAGGCCCGCGGCCATGGCCGTCGTCGTCATCGCCGGGTTGGCGTTGCTG
Transcript >Ophio5|1791
ATGTGTGCGGCCGAGTACACCGGCTGCCTTGCCTATAACCCTTTCGGTTCCGACGGAACGCTTCTCGAGCCTACG
GCCTGTTCTCTGGGCAGCGCGCCTACCGCTGCTCCGGGTTTCGGCGGCAGTGCTCCGACGGATGGCGTTCCGAAT
GGAGGTGTCTCCCCCGACGGCCTTCCCAGCGCCAGCGCCTCTCTGACGGGCAGCGAAGCGGCCCCAGTCGTCACG
GCGGGAGGGGAACGCATCAGGCCCGCGGCCATGGCCGTCGTCGTCATCGCCGGGTTGGCGTTGCTGTGA
Gene >Ophio5|1791
ATGTGTGCGGCCGAGTACACCGGCTGCCTTGCCTATAACCCTTTCGGTTCCGACGGAACGCTTCTCGAGCCTACG
GCCTGTTCTCTGGGCAGCGCGCCTACCGCTGCTCCGGGTTTCGGCGGCAGTGCTCCGACGGATGGCGTTCCGAAT
GGAGGTGTCTCCCCCGACGGCCTTCCCAGCGCCAGCGCCTCTCTGACGGGCAGCGAAGCGGCCCCAGTCGTCACG
GCGGGAGGGGAACGCATCAGGCCCGCGGCCATGGCCGTCGTCGTCATCGCCGGGTTGGCGTTGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail