Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|179
Gene name
Locationscaffold_1028:374..1922
Strand-
Gene length (bp)1548
Transcript length (bp)1398
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10104 Brr6_like_C_C Di-sulfide bridge nucleocytoplasmic transport domain 2.1E-36 244 366

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0055088 lipid homeostasis Yes
GO:0031965 nuclear membrane Yes
GO:0031090 organelle membrane No
GO:0065007 biological regulation No
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0042592 homeostatic process No
GO:0005575 cellular_component No
GO:0065008 regulation of biological quality No
GO:0008150 biological_process No
GO:0048878 chemical homeostasis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 248 267 19
2 351 370 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|179
MESRTSEGPMDWEYQGRGPLDPTSPFSHAARNAQRNLFGSPADSPVRPANPLPTPSKMQQQPPPQAARFTPQLPP
RNMAPPFRNPAFSTPRRPFDEVVMSEASGAEDSPAATEVSDYPNDTPEADHRAEAHSAISMTPLKIDKSSRYGKF
KKHAPGKGEIRGRRDASVGMRKRKRHNHDRDVGSVNRDYHGHDSEAWDSESESDNGAGGRRIWSRSAKRENQGAF
ESFFQALNKYPNTPDHMQRWMQFGANLFLVSVLAYLGWSVVSTVRSDIYKANDVARQELVSRMTECQTQYTMNEC
SKKDRPALRVMCDEWYDCMMQNPESILRVKVTAKQVAEIINEFSETMHLKAWGIVLAFILVCTTVNVGSLNRQGG
HKPTAPAPIPQPSSAVADADAARSPGIAPGYMLVPVHTPRVSRRAQLDEGTDTDTSPLNLKAALSQFTPSRHKSP
SKQFSAMKNRAPKQW
Coding >Ophio5|179
ATGGAATCGAGGACGTCCGAAGGTCCCATGGACTGGGAATACCAGGGTCGTGGCCCTCTCGATCCCACCAGTCCG
TTTTCACATGCGGCGAGGAACGCGCAGCGAAACTTGTTTGGCTCGCCCGCAGACTCTCCAGTCCGTCCCGCAAAC
CCACTCCCGACGCCGTCCAAGATGCAGCAGCAACCACCGCCACAGGCAGCCCGCTTCACACCACAACTGCCTCCG
AGGAACATGGCGCCTCCGTTTCGAAACCCAGCCTTCTCGACACCCAGACGGCCGTTTGATGAGGTGGTCATGTCG
GAGGCGTCGGGCGCCGAGGACAGCCCTGCGGCGACGGAAGTGTCCGACTATCCCAACGATACGCCCGAGGCAGAC
CACAGAGCAGAGGCCCACAGTGCCATCTCGATGACGCCGCTCAAGATCGACAAGTCAAGCCGTTATGGCAAGTTC
AAGAAACACGCGCCGGGAAAGGGGGAGATACGGGGGCGCAGAGATGCCTCGGTCGGGATGAGAAAGCGCAAACGG
CACAATCACGACAGAGACGTCGGGTCCGTCAATCGTGACTACCACGGGCACGACAGCGAAGCCTGGGACTCGGAA
TCCGAGTCGGACAATGGCGCGGGCGGGCGGCGCATTTGGTCACGGTCCGCCAAGCGCGAGAACCAAGGGGCTTTC
GAGTCGTTCTTCCAAGCCCTCAATAAATACCCCAACACGCCCGACCACATGCAGCGATGGATGCAATTCGGCGCC
AACCTGTTTCTCGTCTCGGTGCTGGCCTACCTCGGCTGGTCCGTCGTGAGCACCGTTCGCAGCGACATATACAAG
GCCAACGACGTGGCCCGACAAGAGCTCGTCAGCAGGATGACGGAGTGCCAGACGCAGTACACGATGAACGAATGC
TCTAAAAAGGACCGTCCGGCCCTCCGAGTCATGTGCGACGAGTGGTACGACTGCATGATGCAGAACCCCGAGTCG
ATTCTGAGAGTAAAGGTCACGGCAAAGCAGGTGGCGGAGATCATCAACGAGTTTTCCGAGACGATGCATCTCAAG
GCCTGGGGTATCGTGCTGGCCTTTATCTTGGTGTGCACCACGGTCAATGTCGGGTCGCTCAACCGACAAGGCGGC
CATAAGCCCACCGCTCCGGCACCGATACCTCAGCCGAGCAGCGCGGTGGCAGACGCCGATGCTGCGAGATCGCCC
GGCATCGCTCCCGGATACATGTTGGTACCGGTGCATACGCCGAGGGTATCGCGCCGGGCACAGCTGGACGAGGGG
ACAGACACGGACACGTCGCCGCTCAACCTGAAGGCGGCCCTGTCGCAGTTCACACCTTCCAGACACAAGAGTCCG
AGTAAGCAGTTTAGCGCGATGAAGAACAGGGCACCGAAACAGTGG
Transcript >Ophio5|179
ATGGAATCGAGGACGTCCGAAGGTCCCATGGACTGGGAATACCAGGGTCGTGGCCCTCTCGATCCCACCAGTCCG
TTTTCACATGCGGCGAGGAACGCGCAGCGAAACTTGTTTGGCTCGCCCGCAGACTCTCCAGTCCGTCCCGCAAAC
CCACTCCCGACGCCGTCCAAGATGCAGCAGCAACCACCGCCACAGGCAGCCCGCTTCACACCACAACTGCCTCCG
AGGAACATGGCGCCTCCGTTTCGAAACCCAGCCTTCTCGACACCCAGACGGCCGTTTGATGAGGTGGTCATGTCG
GAGGCGTCGGGCGCCGAGGACAGCCCTGCGGCGACGGAAGTGTCCGACTATCCCAACGATACGCCCGAGGCAGAC
CACAGAGCAGAGGCCCACAGTGCCATCTCGATGACGCCGCTCAAGATCGACAAGTCAAGCCGTTATGGCAAGTTC
AAGAAACACGCGCCGGGAAAGGGGGAGATACGGGGGCGCAGAGATGCCTCGGTCGGGATGAGAAAGCGCAAACGG
CACAATCACGACAGAGACGTCGGGTCCGTCAATCGTGACTACCACGGGCACGACAGCGAAGCCTGGGACTCGGAA
TCCGAGTCGGACAATGGCGCGGGCGGGCGGCGCATTTGGTCACGGTCCGCCAAGCGCGAGAACCAAGGGGCTTTC
GAGTCGTTCTTCCAAGCCCTCAATAAATACCCCAACACGCCCGACCACATGCAGCGATGGATGCAATTCGGCGCC
AACCTGTTTCTCGTCTCGGTGCTGGCCTACCTCGGCTGGTCCGTCGTGAGCACCGTTCGCAGCGACATATACAAG
GCCAACGACGTGGCCCGACAAGAGCTCGTCAGCAGGATGACGGAGTGCCAGACGCAGTACACGATGAACGAATGC
TCTAAAAAGGACCGTCCGGCCCTCCGAGTCATGTGCGACGAGTGGTACGACTGCATGATGCAGAACCCCGAGTCG
ATTCTGAGAGTAAAGGTCACGGCAAAGCAGGTGGCGGAGATCATCAACGAGTTTTCCGAGACGATGCATCTCAAG
GCCTGGGGTATCGTGCTGGCCTTTATCTTGGTGTGCACCACGGTCAATGTCGGGTCGCTCAACCGACAAGGCGGC
CATAAGCCCACCGCTCCGGCACCGATACCTCAGCCGAGCAGCGCGGTGGCAGACGCCGATGCTGCGAGATCGCCC
GGCATCGCTCCCGGATACATGTTGGTACCGGTGCATACGCCGAGGGTATCGCGCCGGGCACAGCTGGACGAGGGG
ACAGACACGGACACGTCGCCGCTCAACCTGAAGGCGGCCCTGTCGCAGTTCACACCTTCCAGACACAAGAGTCCG
AGTAAGCAGTTTAGCGCGATGAAGAACAGGGCACCGAAACAGTGGTGA
Gene >Ophio5|179
ATGGAATCGAGGACGTCCGAAGGTCCCATGGACTGGGAATACCAGGGTCGTGGCCCTCTCGATCCCACCAGTCCG
TTTTCACATGCGGCGAGGAACGCGCAGCGAAACTGTGAGCGTCCCAATCTGCAAGTCGAGGATCACGGGCCATGC
TGGCCCCTTTGGAATTGGCCTCTACCGTTGAGGCGGCGACTGATGCAGATTCTCAAGTGTTTGGCTCGCCCGCAG
ACTCTCCAGTCCGTCCCGCAAACCCACTCCCGACGCCGTCCAAGATGCAGCAGCAACCACCGCCACAGGCAGCCC
GCTTCACACCACAACTGCCTCCGAGGAACATGGCGCCTCCGTTTCGAAACCCAGCCTTCTCGACACCCAGACGGC
CGTTTGATGAGGTGGTCATGTCGGAGGCGTCGGGCGCCGAGGACAGCCCTGCGGCGACGGAAGTGTCCGACTATC
CCAACGATACGCCCGAGGCAGACCACAGAGCAGAGGCCCACAGTGCCATCTCGATGACGCCGCTCAAGATCGACA
AGTCAAGCCGTTATGGCAAGTTCAAGAAACACGCGCCGGGAAAGGGGGAGATACGGGGGCGCAGAGATGCCTCGG
TCGGGATGAGAAAGCGCAAACGGCACAATCACGACAGAGACGTCGGGTCCGTCAATCGTGACTACCACGGGCACG
ACAGCGAAGCCTGGGACTCGGAATCCGAGTCGGACAATGGCGCGGGCGGGCGGCGCATTTGGTCACGGTCCGCCA
AGCGCGAGAACCAAGGGGCTTTCGAGTCGTTCTTCCAAGCCCTCAATAAATACCCCAACACGCCCGACCACATGC
AGCGATGGATGCAATTCGGCGCCAACCTGTTTCTCGTCTCGGTGCTGGCCTACCTCGGCTGGTCCGTCGTGAGCA
CCGTTCGCAGCGACATATACAAGGCCAACGACGTGGCCCGACAAGAGCTCGTCAGCAGGATGACGGAGTGCCAGA
CGCAGTACACGATGAACGAATGCTCTAAAAAGGACCGTCCGGCCCTCCGAGTCATGTGCGACGAGTGGTACGACT
GCATGATGCAGAACCCCGAGTCGATTCTGAGAGTAAAGGTCACGGCAAAGCAGGTGGCGGAGATCATCAACGAGT
TTTCCGAGACGATGCATCTCAAGGCCTGGGTAAGTTGCTCCCGTCTCTCGTGGGCGTACAAGGTCGCCAACTCGC
TTCCAGGGTATCGTGCTGGCCTTTATCTTGGTGTGCACCACGGTCAATGTCGGGTCGCTCAACCGACAAGGCGGC
CATAAGCCCACCGCTCCGGCACCGATACCTCAGCCGAGCAGCGCGGTGGCAGACGCCGATGCTGCGAGATCGCCC
GGCATCGCTCCCGGATACATGTTGGTACCGGTGCATACGCCGAGGGTATCGCGCCGGGCACAGCTGGACGAGGGG
ACAGACACGGACACGTCGCCGCTCAACCTGAAGGCGGCCCTGTCGCAGTTCACACCTTCCAGACACAAGAGTCCG
AGTAAGCAGTTTAGCGCGATGAAGAACAGGGCACCGAAACAGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail