Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1789
Gene name
Locationscaffold_168:28137..29402
Strand-
Gene length (bp)1265
Transcript length (bp)1188
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07687 M20_dimer Peptidase dimerisation domain 2.3E-18 208 295
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 1.0E-15 103 391

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CI30|Y3666_SORMK Peptidase M20 domain-containing protein SMAC_03666.2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_03666.2 PE=3 SV=2 13 394 5.0E-140
sp|Q4WNC9|P20D1_ASPFU Probable carboxypeptidase AFUA_6G06800 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G06800 PE=3 SV=1 34 394 8.0E-99
sp|B0Y766|P20D1_ASPFC Probable carboxypeptidase AFUB_072730 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_072730 PE=3 SV=1 34 394 8.0E-99
sp|A1DM79|P20D1_NEOFI Probable carboxypeptidase NFIA_052450 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_052450 PE=3 SV=1 34 394 1.0E-96
sp|A2RBC2|P20D1_ASPNC Probable carboxypeptidase An18g06210 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g06210 PE=3 SV=1 34 390 2.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CI30|Y3666_SORMK Peptidase M20 domain-containing protein SMAC_03666.2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_03666.2 PE=3 SV=2 13 394 5.0E-140
sp|Q4WNC9|P20D1_ASPFU Probable carboxypeptidase AFUA_6G06800 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G06800 PE=3 SV=1 34 394 8.0E-99
sp|B0Y766|P20D1_ASPFC Probable carboxypeptidase AFUB_072730 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_072730 PE=3 SV=1 34 394 8.0E-99
sp|A1DM79|P20D1_NEOFI Probable carboxypeptidase NFIA_052450 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_052450 PE=3 SV=1 34 394 1.0E-96
sp|A2RBC2|P20D1_ASPNC Probable carboxypeptidase An18g06210 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g06210 PE=3 SV=1 34 390 2.0E-95
sp|Q2UMC1|P20D2_ASPOR Probable carboxypeptidase AO090003000058 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090003000058 PE=3 SV=1 22 394 5.0E-95
sp|B8N4P0|P20D2_ASPFN Probable carboxypeptidase AFLA_037450 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_037450 PE=3 SV=1 22 394 8.0E-95
sp|E4UW91|P20D1_ARTGP Probable carboxypeptidase MGYG_04702 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_04702 PE=3 SV=1 34 393 2.0E-90
sp|Q5B131|P20D1_EMENI Probable carboxypeptidase AN5749 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5749 PE=3 SV=1 1 394 5.0E-90
sp|C4JXT1|P20D1_UNCRE Probable carboxypeptidase UREG_07869 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07869 PE=3 SV=1 1 390 1.0E-89
sp|C5FXY7|P20D1_ARTOC Probable carboxypeptidase MCYG_07204 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07204 PE=3 SV=1 34 394 4.0E-89
sp|E9DG92|P20D1_COCPS Probable carboxypeptidase CPSG_08841 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_08841 PE=3 SV=1 34 390 6.0E-89
sp|D4AXX2|P20D1_ARTBC Probable carboxypeptidase ARB_01041 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01041 PE=3 SV=1 34 393 8.0E-89
sp|D4D6R4|P20D1_TRIVH Probable carboxypeptidase TRV_02791 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02791 PE=3 SV=1 34 393 2.0E-88
sp|C5PE42|P20D1_COCP7 Probable carboxypeptidase CPC735_001200 OS=Coccidioides posadasii (strain C735) GN=CPC735_001200 PE=3 SV=1 34 390 2.0E-88
sp|C0S1J6|P20D1_PARBP Probable carboxypeptidase PABG_01461 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_01461 PE=3 SV=1 4 390 8.0E-87
sp|A1CAX3|P20D2_ASPCL Probable carboxypeptidase ACLA_013260 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_013260 PE=3 SV=1 1 395 1.0E-86
sp|Q0CTS9|P20D1_ASPTN Probable carboxypeptidase ATEG_02905 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_02905 PE=3 SV=1 34 394 2.0E-86
sp|C1G9X6|P20D1_PARBD Probable carboxypeptidase PADG_04062 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_04062 PE=3 SV=1 4 390 2.0E-86
sp|B6QHD2|P20D1_TALMQ Probable carboxypeptidase PMAA_093910 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_093910 PE=3 SV=1 34 394 3.0E-85
sp|C0NAB3|P20D1_AJECG Probable carboxypeptidase HCBG_00059 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_00059 PE=3 SV=1 34 390 2.0E-84
sp|C1GQH3|P20D1_PARBA Probable carboxypeptidase PAAG_00768 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_00768 PE=3 SV=1 4 390 1.0E-83
sp|B8NPN0|P20D1_ASPFN Probable carboxypeptidase AFLA_000940 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_000940 PE=3 SV=1 15 394 7.0E-83
sp|C5JH24|P20D1_AJEDS Probable carboxypeptidase BDBG_01803 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_01803 PE=3 SV=1 34 390 2.0E-82
sp|C5GFX4|P20D1_AJEDR Probable carboxypeptidase BDCG_03757 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_03757 PE=3 SV=1 34 390 2.0E-82
sp|Q2U9N9|P20D1_ASPOR Probable carboxypeptidase AO090166000075 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090166000075 PE=3 SV=1 9 394 7.0E-82
sp|A1CE70|P20D1_ASPCL Probable carboxypeptidase ACLA_088580 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_088580 PE=3 SV=1 34 394 2.0E-78
sp|O74916|YJ75_SCHPO Peptidase M20 domain-containing protein C757.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.05c PE=3 SV=1 23 394 6.0E-76
sp|Q5HKI1|DAPE_STAEQ Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dapE PE=3 SV=1 43 390 3.0E-19
sp|Q8CQC2|DAPE_STAES Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dapE PE=3 SV=1 43 390 4.0E-19
sp|A9IR81|DAPE_BORPD Succinyl-diaminopimelate desuccinylase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dapE PE=3 SV=1 34 309 2.0E-18
sp|C5BC62|ARGE_EDWI9 Acetylornithine deacetylase OS=Edwardsiella ictaluri (strain 93-146) GN=argE PE=3 SV=1 36 392 1.0E-17
sp|Q66G73|ARGE_YERPS Acetylornithine deacetylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argE PE=3 SV=1 36 392 1.0E-17
sp|Q8ZA85|ARGE_YERPE Acetylornithine deacetylase OS=Yersinia pestis GN=argE PE=3 SV=1 36 392 1.0E-17
sp|A7FCZ8|ARGE_YERP3 Acetylornithine deacetylase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argE PE=3 SV=1 36 392 1.0E-17
sp|C6DI82|ARGE_PECCP Acetylornithine deacetylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=argE PE=3 SV=1 36 392 4.0E-17
sp|Q6GF48|DAPE_STAAR Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MRSA252) GN=dapE PE=3 SV=1 33 372 5.0E-17
sp|Q6DAR2|ARGE_PECAS Acetylornithine deacetylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argE PE=3 SV=1 36 392 6.0E-17
sp|Q2L2J6|DAPE_BORA1 Succinyl-diaminopimelate desuccinylase OS=Bordetella avium (strain 197N) GN=dapE PE=3 SV=1 34 310 2.0E-16
sp|Q32AB8|ARGE_SHIDS Acetylornithine deacetylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=argE PE=3 SV=1 36 392 9.0E-16
sp|C1D8X7|DAPE_LARHH Succinyl-diaminopimelate desuccinylase OS=Laribacter hongkongensis (strain HLHK9) GN=dapE PE=3 SV=1 37 310 1.0E-15
sp|B7NU43|ARGE_ECO7I Acetylornithine deacetylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|B1LNR7|ARGE_ECOSM Acetylornithine deacetylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|B5Z059|ARGE_ECO5E Acetylornithine deacetylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|Q8X742|ARGE_ECO57 Acetylornithine deacetylase OS=Escherichia coli O157:H7 GN=argE PE=3 SV=1 36 392 1.0E-15
sp|A9MI13|ARGE_SALAR Acetylornithine deacetylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|B7UNT3|ARGE_ECO27 Acetylornithine deacetylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|B6I5H3|ARGE_ECOSE Acetylornithine deacetylase OS=Escherichia coli (strain SE11) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7M711|ARGE_ECO8A Acetylornithine deacetylase OS=Escherichia coli O8 (strain IAI1) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|Q8FB97|ARGE_ECOL6 Acetylornithine deacetylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argE PE=3 SV=2 36 392 2.0E-15
sp|Q0TAA3|ARGE_ECOL5 Acetylornithine deacetylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7MR48|ARGE_ECO81 Acetylornithine deacetylase OS=Escherichia coli O81 (strain ED1a) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7MI93|ARGE_ECO45 Acetylornithine deacetylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|P23908|ARGE_ECOLI Acetylornithine deacetylase OS=Escherichia coli (strain K12) GN=argE PE=1 SV=2 36 392 2.0E-15
sp|B1IVC1|ARGE_ECOLC Acetylornithine deacetylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B1XBC2|ARGE_ECODH Acetylornithine deacetylase OS=Escherichia coli (strain K12 / DH10B) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|C5A0C3|ARGE_ECOBW Acetylornithine deacetylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7LA57|ARGE_ECO55 Acetylornithine deacetylase OS=Escherichia coli (strain 55989 / EAEC) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|Q31U31|ARGE_SHIBS Acetylornithine deacetylase OS=Shigella boydii serotype 4 (strain Sb227) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|Q8ZKL9|ARGE_SALTY Acetylornithine deacetylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7NFQ7|ARGE_ECOLU Acetylornithine deacetylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|Q0SY37|ARGE_SHIF8 Acetylornithine deacetylase OS=Shigella flexneri serotype 5b (strain 8401) GN=argE PE=3 SV=1 36 392 3.0E-15
sp|P59600|ARGE_SHIFL Acetylornithine deacetylase OS=Shigella flexneri GN=argE PE=3 SV=1 36 392 3.0E-15
sp|A8A765|ARGE_ECOHS Acetylornithine deacetylase OS=Escherichia coli O9:H4 (strain HS) GN=argE PE=3 SV=1 36 392 3.0E-15
sp|B2TWF2|ARGE_SHIB3 Acetylornithine deacetylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=argE PE=3 SV=1 36 392 3.0E-15
sp|A7ZUH5|ARGE_ECO24 Acetylornithine deacetylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argE PE=3 SV=1 36 392 3.0E-15
sp|Q31G37|DAPE_THICR Succinyl-diaminopimelate desuccinylase OS=Thiomicrospira crunogena (strain XCL-2) GN=dapE PE=3 SV=1 34 309 4.0E-15
sp|B5F0U6|ARGE_SALA4 Acetylornithine deacetylase OS=Salmonella agona (strain SL483) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B4TQH3|ARGE_SALSV Acetylornithine deacetylase OS=Salmonella schwarzengrund (strain CVM19633) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|A9N0G7|ARGE_SALPB Acetylornithine deacetylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B4T0W8|ARGE_SALNS Acetylornithine deacetylase OS=Salmonella newport (strain SL254) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B5RF48|ARGE_SALG2 Acetylornithine deacetylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B5QXQ2|ARGE_SALEP Acetylornithine deacetylase OS=Salmonella enteritidis PT4 (strain P125109) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B5FPX2|ARGE_SALDC Acetylornithine deacetylase OS=Salmonella dublin (strain CT_02021853) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|Q57H96|ARGE_SALCH Acetylornithine deacetylase OS=Salmonella choleraesuis (strain SC-B67) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B5BJN1|ARGE_SALPK Acetylornithine deacetylase OS=Salmonella paratyphi A (strain AKU_12601) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|Q5PK76|ARGE_SALPA Acetylornithine deacetylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|A9BZY6|DAPE_DELAS Succinyl-diaminopimelate desuccinylase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dapE PE=3 SV=1 34 323 5.0E-15
sp|A4WG54|ARGE_ENT38 Acetylornithine deacetylase OS=Enterobacter sp. (strain 638) GN=argE PE=3 SV=1 36 392 6.0E-15
sp|B2VGA3|ARGE_ERWT9 Acetylornithine deacetylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argE PE=3 SV=1 36 392 8.0E-15
sp|B7LUN8|ARGE_ESCF3 Acetylornithine deacetylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=argE PE=3 SV=1 36 392 1.0E-14
sp|B4TCQ3|ARGE_SALHS Acetylornithine deacetylase OS=Salmonella heidelberg (strain SL476) GN=argE PE=3 SV=1 36 392 1.0E-14
sp|Q9PH30|DAPE_XYLFA Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain 9a5c) GN=dapE PE=3 SV=1 34 280 1.0E-14
sp|Q931I4|DAPE_STAAM Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapE PE=3 SV=1 33 372 2.0E-14
sp|Q0A7H5|DAPE_ALKEH Succinyl-diaminopimelate desuccinylase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dapE PE=3 SV=1 34 310 2.0E-14
sp|P57155|ARGE_BUCAI Acetylornithine deacetylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argE PE=3 SV=1 36 374 2.0E-14
sp|Q8NVL7|DAPE_STAAW Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MW2) GN=dapE PE=3 SV=1 33 372 2.0E-14
sp|Q6G7T6|DAPE_STAAS Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MSSA476) GN=dapE PE=3 SV=1 33 372 2.0E-14
sp|Q99SN6|DAPE_STAAN Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain N315) GN=dapE PE=1 SV=1 33 372 2.0E-14
sp|Q8Z308|ARGE_SALTI Acetylornithine deacetylase OS=Salmonella typhi GN=argE PE=3 SV=1 36 392 3.0E-14
sp|B0RW53|DAPE_XANCB Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=dapE PE=3 SV=1 34 310 4.0E-14
sp|Q7W8Y3|DAPE_BORPA Succinyl-diaminopimelate desuccinylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dapE PE=3 SV=1 34 310 4.0E-14
sp|A1W7M0|DAPE_ACISJ Succinyl-diaminopimelate desuccinylase OS=Acidovorax sp. (strain JS42) GN=dapE PE=3 SV=1 34 310 4.0E-14
sp|A1UUD2|DAPE_BARBK Succinyl-diaminopimelate desuccinylase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dapE PE=3 SV=1 37 287 4.0E-14
sp|Q8PAU0|DAPE_XANCP Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dapE PE=3 SV=2 34 310 4.0E-14
sp|Q4USS4|DAPE_XANC8 Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dapE PE=3 SV=2 34 310 4.0E-14
sp|B8D6V9|ARGE_BUCAT Acetylornithine deacetylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=argE PE=3 SV=1 36 374 5.0E-14
sp|Q3YV19|ARGE_SHISS Acetylornithine deacetylase OS=Shigella sonnei (strain Ss046) GN=argE PE=3 SV=1 36 392 5.0E-14
sp|O34984|YODQ_BACSU Uncharacterized metallohydrolase YodQ OS=Bacillus subtilis (strain 168) GN=yodQ PE=3 SV=1 101 394 7.0E-14
sp|C5CLT2|DAPE_VARPS Succinyl-diaminopimelate desuccinylase OS=Variovorax paradoxus (strain S110) GN=dapE PE=3 SV=1 34 309 7.0E-14
sp|B5ES53|DAPE_ACIF5 Succinyl-diaminopimelate desuccinylase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dapE PE=3 SV=1 33 309 7.0E-14
sp|B7JBS5|DAPE_ACIF2 Succinyl-diaminopimelate desuccinylase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dapE PE=3 SV=1 33 309 7.0E-14
sp|B5XZ19|ARGE_KLEP3 Acetylornithine deacetylase OS=Klebsiella pneumoniae (strain 342) GN=argE PE=3 SV=1 36 392 7.0E-14
sp|B9MJL1|DAPE_ACIET Succinyl-diaminopimelate desuccinylase OS=Acidovorax ebreus (strain TPSY) GN=dapE PE=3 SV=1 34 310 9.0E-14
sp|Q5QTZ3|DAPE_IDILO Succinyl-diaminopimelate desuccinylase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dapE PE=3 SV=1 34 310 1.0E-13
sp|B0U296|DAPE_XYLFM Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain M12) GN=dapE PE=3 SV=1 34 280 2.0E-13
sp|Q7MYD5|ARGE_PHOLL Acetylornithine deacetylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argE PE=3 SV=1 36 392 2.0E-13
sp|A1WEL1|DAPE_VEREI Succinyl-diaminopimelate desuccinylase OS=Verminephrobacter eiseniae (strain EF01-2) GN=dapE PE=3 SV=1 37 310 2.0E-13
sp|Q1R039|DAPE_CHRSD Succinyl-diaminopimelate desuccinylase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dapE PE=3 SV=1 22 234 2.0E-13
sp|B4F192|ARGE_PROMH Acetylornithine deacetylase OS=Proteus mirabilis (strain HI4320) GN=argE PE=3 SV=1 36 390 2.0E-13
sp|A1U3R0|DAPE_MARHV Succinyl-diaminopimelate desuccinylase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dapE PE=3 SV=1 34 310 3.0E-13
sp|Q7MH69|ARGE_VIBVY Acetylornithine deacetylase OS=Vibrio vulnificus (strain YJ016) GN=argE PE=3 SV=1 50 384 3.0E-13
sp|Q82XY4|DAPE_NITEU Succinyl-diaminopimelate desuccinylase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dapE PE=3 SV=1 37 310 4.0E-13
sp|B4RKY8|DAPE_NEIG2 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=dapE PE=3 SV=2 33 310 5.0E-13
sp|B6EJS8|DAPE_ALISL Succinyl-diaminopimelate desuccinylase OS=Aliivibrio salmonicida (strain LFI1238) GN=dapE PE=3 SV=1 37 310 5.0E-13
sp|Q8DBA6|DAPE_VIBVU Succinyl-diaminopimelate desuccinylase OS=Vibrio vulnificus (strain CMCP6) GN=dapE PE=3 SV=1 34 312 5.0E-13
sp|Q7WKC6|DAPE_BORBR Succinyl-diaminopimelate desuccinylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dapE PE=3 SV=1 34 310 5.0E-13
sp|A4G4Q7|DAPE_HERAR Succinyl-diaminopimelate desuccinylase OS=Herminiimonas arsenicoxydans GN=dapE PE=3 SV=1 34 324 6.0E-13
sp|Q3SJE0|DAPE_THIDA Succinyl-diaminopimelate desuccinylase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dapE PE=3 SV=1 34 296 7.0E-13
sp|Q5F812|DAPE_NEIG1 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dapE PE=3 SV=1 33 310 7.0E-13
sp|B8D8K5|ARGE_BUCA5 Acetylornithine deacetylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=argE PE=3 SV=1 36 374 8.0E-13
sp|Q21WT4|DAPE_RHOFT Succinyl-diaminopimelate desuccinylase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dapE PE=3 SV=1 37 310 8.0E-13
sp|A9ILD7|DAPE_BART1 Succinyl-diaminopimelate desuccinylase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dapE PE=3 SV=1 37 287 8.0E-13
sp|Q12C18|DAPE_POLSJ Succinyl-diaminopimelate desuccinylase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dapE PE=3 SV=1 34 310 8.0E-13
sp|Q0BUB7|DAPE_GRABC Succinyl-diaminopimelate desuccinylase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dapE PE=3 SV=2 34 304 9.0E-13
sp|Q9JYL2|DAPE_NEIMB Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=dapE PE=1 SV=1 33 310 1.0E-12
sp|Q87F49|DAPE_XYLFT Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dapE PE=3 SV=1 34 280 1.0E-12
sp|B2I6B4|DAPE_XYLF2 Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain M23) GN=dapE PE=3 SV=1 34 280 1.0E-12
sp|A1KUW7|DAPE_NEIMF Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dapE PE=3 SV=1 33 310 1.0E-12
sp|Q3BVJ3|DAPE_XANC5 Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dapE PE=3 SV=1 34 310 1.0E-12
sp|Q9CLT9|ARGE_PASMU Acetylornithine deacetylase OS=Pasteurella multocida (strain Pm70) GN=argE PE=3 SV=2 58 390 1.0E-12
sp|Q9YBY3|LYSK_AERPE N-acetyl-lysine deacetylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=lysK PE=3 SV=2 50 390 1.0E-12
sp|A9HKR2|DAPE_GLUDA Succinyl-diaminopimelate desuccinylase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dapE PE=3 SV=1 24 287 1.0E-12
sp|Q2Y7X4|DAPE_NITMU Succinyl-diaminopimelate desuccinylase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dapE PE=3 SV=1 34 310 1.0E-12
sp|B2SQY5|DAPE_XANOP Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dapE PE=3 SV=1 34 310 2.0E-12
sp|Q7VXJ5|DAPE_BORPE Succinyl-diaminopimelate desuccinylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dapE PE=3 SV=1 34 310 2.0E-12
sp|Q8DCN1|ARGE_VIBVU Acetylornithine deacetylase OS=Vibrio vulnificus (strain CMCP6) GN=argE PE=3 SV=1 50 384 2.0E-12
sp|A2SGS4|DAPE_METPP Succinyl-diaminopimelate desuccinylase OS=Methylibium petroleiphilum (strain PM1) GN=dapE PE=3 SV=1 37 309 2.0E-12
sp|A9M0W6|DAPE_NEIM0 Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C (strain 053442) GN=dapE PE=3 SV=1 33 310 2.0E-12
sp|C5BQE9|DAPE_TERTT Succinyl-diaminopimelate desuccinylase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dapE PE=3 SV=1 34 304 2.0E-12
sp|Q5H1C8|DAPE_XANOR Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dapE PE=3 SV=2 34 310 2.0E-12
sp|Q2P492|DAPE_XANOM Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dapE PE=3 SV=1 34 310 2.0E-12
sp|A1ISU7|DAPE_NEIMA Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dapE PE=3 SV=1 33 310 2.0E-12
sp|Q3J9B0|DAPE_NITOC Succinyl-diaminopimelate desuccinylase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dapE PE=3 SV=1 34 287 2.0E-12
sp|B5FBP7|ARGE_VIBFM Acetylornithine deacetylase OS=Vibrio fischeri (strain MJ11) GN=argE PE=3 SV=1 106 383 3.0E-12
sp|Q7MIL6|DAPE_VIBVY Succinyl-diaminopimelate desuccinylase OS=Vibrio vulnificus (strain YJ016) GN=dapE PE=3 SV=2 34 312 3.0E-12
sp|B3CRZ3|DAPE_ORITI Succinyl-diaminopimelate desuccinylase OS=Orientia tsutsugamushi (strain Ikeda) GN=dapE PE=3 SV=1 33 312 3.0E-12
sp|A3QGR1|DAPE2_SHELP Succinyl-diaminopimelate desuccinylase 2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dapE2 PE=3 SV=1 41 326 3.0E-12
sp|Q1LNH3|DAPE_CUPMC Succinyl-diaminopimelate desuccinylase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dapE PE=3 SV=1 37 309 3.0E-12
sp|A6SZR5|DAPE_JANMA Succinyl-diaminopimelate desuccinylase OS=Janthinobacterium sp. (strain Marseille) GN=dapE PE=3 SV=1 34 310 4.0E-12
sp|Q5E2E4|ARGE_VIBF1 Acetylornithine deacetylase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argE PE=3 SV=1 106 383 4.0E-12
sp|Q8PMJ5|DAPE_XANAC Succinyl-diaminopimelate desuccinylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dapE PE=3 SV=1 34 310 4.0E-12
sp|P9WHS9|DAPE_MYCTU Putative succinyl-diaminopimelate desuccinylase DapE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dapE PE=1 SV=1 33 384 4.0E-12
sp|P9WHS8|DAPE_MYCTO Putative succinyl-diaminopimelate desuccinylase DapE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dapE PE=3 SV=1 33 384 4.0E-12
sp|A1S647|DAPE_SHEAM Succinyl-diaminopimelate desuccinylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dapE PE=3 SV=1 28 287 4.0E-12
sp|B4SQ35|DAPE_STRM5 Succinyl-diaminopimelate desuccinylase OS=Stenotrophomonas maltophilia (strain R551-3) GN=dapE PE=3 SV=1 34 310 5.0E-12
sp|C3LPF7|DAPE_VIBCM Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dapE PE=3 SV=1 34 309 5.0E-12
sp|Q9KQ52|DAPE_VIBCH Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dapE PE=1 SV=1 34 309 5.0E-12
sp|A5F6B5|DAPE_VIBC3 Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dapE PE=3 SV=1 34 309 5.0E-12
sp|P59085|ARGE_BUCAP Acetylornithine deacetylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argE PE=3 SV=1 36 390 6.0E-12
sp|Q5FPX5|DAPE_GLUOX Succinyl-diaminopimelate desuccinylase OS=Gluconobacter oxydans (strain 621H) GN=dapE PE=3 SV=2 32 287 7.0E-12
sp|A0R2G4|DAPE_MYCS2 Succinyl-diaminopimelate desuccinylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dapE PE=3 SV=1 37 390 1.0E-11
sp|A1TQ19|DAPE_ACIAC Succinyl-diaminopimelate desuccinylase OS=Acidovorax citrulli (strain AAC00-1) GN=dapE PE=3 SV=1 34 310 1.0E-11
sp|B2FIC0|DAPE_STRMK Succinyl-diaminopimelate desuccinylase OS=Stenotrophomonas maltophilia (strain K279a) GN=dapE PE=3 SV=1 34 308 1.0E-11
sp|Q0ADY0|DAPE_NITEC Succinyl-diaminopimelate desuccinylase OS=Nitrosomonas eutropha (strain C91) GN=dapE PE=3 SV=1 37 310 2.0E-11
sp|Q7NY19|DAPE_CHRVO Succinyl-diaminopimelate desuccinylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dapE PE=3 SV=1 34 310 2.0E-11
sp|Q5E3I7|DAPE_VIBF1 Succinyl-diaminopimelate desuccinylase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dapE PE=3 SV=1 27 314 2.0E-11
sp|P59601|ARGE_VIBPA Acetylornithine deacetylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argE PE=3 SV=1 50 384 2.0E-11
sp|Q15TS8|DAPE_PSEA6 Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dapE PE=3 SV=1 35 312 2.0E-11
sp|B7VLL4|ARGE_VIBTL Acetylornithine deacetylase OS=Vibrio tasmaniensis (strain LGP32) GN=argE PE=3 SV=1 36 384 2.0E-11
sp|Q0VQG3|DAPE_ALCBS Succinyl-diaminopimelate desuccinylase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapE PE=3 SV=1 85 395 2.0E-11
sp|Q5P9A2|DAPE_ANAMM Succinyl-diaminopimelate desuccinylase OS=Anaplasma marginale (strain St. Maries) GN=dapE PE=3 SV=2 37 390 3.0E-11
sp|B9KHC9|DAPE_ANAMF Succinyl-diaminopimelate desuccinylase OS=Anaplasma marginale (strain Florida) GN=dapE PE=3 SV=2 37 390 3.0E-11
sp|B1ZGA7|DAPE_METPB Succinyl-diaminopimelate desuccinylase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dapE PE=3 SV=1 37 302 4.0E-11
sp|A8FW04|DAPE_SHESH Succinyl-diaminopimelate desuccinylase OS=Shewanella sediminis (strain HAW-EB3) GN=dapE PE=3 SV=1 34 309 5.0E-11
sp|A1SXF9|DAPE_PSYIN Succinyl-diaminopimelate desuccinylase OS=Psychromonas ingrahamii (strain 37) GN=dapE PE=3 SV=1 34 287 5.0E-11
sp|A7MXC2|ARGE_VIBCB Acetylornithine deacetylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=argE PE=3 SV=1 50 384 5.0E-11
sp|Q3YT10|DAPE_EHRCJ Succinyl-diaminopimelate desuccinylase OS=Ehrlichia canis (strain Jake) GN=dapE PE=3 SV=2 37 287 6.0E-11
sp|Q2GAU5|DAPE_NOVAD Succinyl-diaminopimelate desuccinylase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dapE PE=3 SV=1 39 302 7.0E-11
sp|B0BTF3|DAPE_ACTPJ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dapE PE=3 SV=1 33 287 9.0E-11
sp|Q9CM22|DAPE_PASMU Succinyl-diaminopimelate desuccinylase OS=Pasteurella multocida (strain Pm70) GN=dapE PE=3 SV=1 33 298 9.0E-11
sp|Q6VE94|DAPE_PSESY Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. syringae GN=dapE PE=3 SV=1 34 310 1.0E-10
sp|Q59284|DAPE_CORGL Succinyl-diaminopimelate desuccinylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dapE PE=1 SV=1 39 289 1.0E-10
sp|Q8XZK5|DAPE_RALSO Succinyl-diaminopimelate desuccinylase OS=Ralstonia solanacearum (strain GMI1000) GN=dapE PE=3 SV=2 34 309 1.0E-10
sp|Q2W0E7|DAPE_MAGSA Succinyl-diaminopimelate desuccinylase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dapE PE=3 SV=1 37 287 1.0E-10
sp|B6EMN5|ARGE_ALISL Acetylornithine deacetylase OS=Aliivibrio salmonicida (strain LFI1238) GN=argE PE=3 SV=1 106 383 1.0E-10
sp|Q492F7|DAPE_BLOPB Succinyl-diaminopimelate desuccinylase OS=Blochmannia pennsylvanicus (strain BPEN) GN=dapE PE=3 SV=1 34 310 1.0E-10
sp|B8F824|DAPE_HAEPS Succinyl-diaminopimelate desuccinylase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dapE PE=3 SV=1 33 287 1.0E-10
sp|Q2NS82|DAPE_SODGM Succinyl-diaminopimelate desuccinylase OS=Sodalis glossinidius (strain morsitans) GN=dapE PE=3 SV=1 36 289 1.0E-10
sp|A5CCZ1|DAPE_ORITB Succinyl-diaminopimelate desuccinylase OS=Orientia tsutsugamushi (strain Boryong) GN=dapE PE=3 SV=1 33 312 2.0E-10
sp|Q9I4H5|DAPE_PSEAE Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dapE PE=3 SV=1 26 310 2.0E-10
sp|B7UX27|DAPE_PSEA8 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain LESB58) GN=dapE PE=3 SV=1 26 310 2.0E-10
sp|Q9V1I3|LYSK_PYRAB N-acetyl-lysine deacetylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=lysK PE=3 SV=1 33 225 2.0E-10
sp|B7VIL8|DAPE_VIBTL Succinyl-diaminopimelate desuccinylase OS=Vibrio tasmaniensis (strain LGP32) GN=dapE PE=3 SV=1 34 314 2.0E-10
sp|Q68VN9|DAPE_RICTY Succinyl-diaminopimelate desuccinylase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dapE PE=3 SV=1 41 288 2.0E-10
sp|Q1MM75|DAPE_RHIL3 Succinyl-diaminopimelate desuccinylase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dapE PE=3 SV=1 41 287 2.0E-10
sp|Q1GRJ2|DAPE_SPHAL Succinyl-diaminopimelate desuccinylase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=dapE PE=3 SV=1 37 323 3.0E-10
sp|Q2N7X8|DAPE_ERYLH Succinyl-diaminopimelate desuccinylase OS=Erythrobacter litoralis (strain HTCC2594) GN=dapE PE=3 SV=1 34 305 3.0E-10
sp|A5FYQ7|DAPE_ACICJ Succinyl-diaminopimelate desuccinylase OS=Acidiphilium cryptum (strain JF-5) GN=dapE PE=3 SV=1 34 287 3.0E-10
sp|A4SPS7|DAPE_AERS4 Succinyl-diaminopimelate desuccinylase OS=Aeromonas salmonicida (strain A449) GN=dapE PE=3 SV=1 34 310 3.0E-10
sp|Q7N3J4|DAPE_PHOLL Succinyl-diaminopimelate desuccinylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dapE PE=3 SV=1 36 308 3.0E-10
sp|Q6G1H9|DAPE_BARQU Succinyl-diaminopimelate desuccinylase OS=Bartonella quintana (strain Toulouse) GN=dapE PE=3 SV=1 37 287 4.0E-10
sp|Q02IY2|DAPE_PSEAB Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dapE PE=3 SV=1 26 310 4.0E-10
sp|A6V936|DAPE_PSEA7 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain PA7) GN=dapE PE=3 SV=1 26 310 4.0E-10
sp|A5UFQ7|DAPE_HAEIG Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain PittGG) GN=dapE PE=3 SV=1 33 287 4.0E-10
sp|B4EY70|DAPE_PROMH Succinyl-diaminopimelate desuccinylase OS=Proteus mirabilis (strain HI4320) GN=dapE PE=3 SV=1 36 289 4.0E-10
sp|Q7VF72|DAPE_HELHP Succinyl-diaminopimelate desuccinylase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dapE PE=3 SV=1 37 308 4.0E-10
sp|B6IPH8|DAPE_RHOCS Succinyl-diaminopimelate desuccinylase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dapE PE=3 SV=1 37 287 5.0E-10
sp|Q4QP83|DAPE_HAEI8 Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain 86-028NP) GN=dapE PE=3 SV=1 33 234 5.0E-10
sp|A9W376|DAPE_METEP Succinyl-diaminopimelate desuccinylase OS=Methylobacterium extorquens (strain PA1) GN=dapE PE=3 SV=2 37 302 6.0E-10
sp|B0T134|DAPE_CAUSK Succinyl-diaminopimelate desuccinylase OS=Caulobacter sp. (strain K31) GN=dapE PE=3 SV=2 37 287 7.0E-10
sp|B2T5K8|DAPE_BURPP Succinyl-diaminopimelate desuccinylase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dapE PE=3 SV=1 37 390 7.0E-10
sp|A7ML10|DAPE_CROS8 Succinyl-diaminopimelate desuccinylase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dapE PE=3 SV=1 36 310 8.0E-10
sp|O68873|ARGE_MYXXA Acetylornithine deacetylase OS=Myxococcus xanthus GN=argE PE=1 SV=1 26 379 9.0E-10
sp|Q87MI6|DAPE_VIBPA Succinyl-diaminopimelate desuccinylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dapE PE=3 SV=1 34 312 9.0E-10
sp|Q13XA2|DAPE_BURXL Succinyl-diaminopimelate desuccinylase OS=Burkholderia xenovorans (strain LB400) GN=dapE PE=3 SV=2 37 310 9.0E-10
sp|Q0TF05|DAPE_ECOL5 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dapE PE=3 SV=1 36 310 9.0E-10
sp|A1VN92|DAPE_POLNA Succinyl-diaminopimelate desuccinylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=dapE PE=3 SV=1 34 295 1.0E-09
sp|Q1R8Q6|DAPE_ECOUT Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain UTI89 / UPEC) GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|Q8FF82|DAPE_ECOL6 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|A1ADX7|DAPE_ECOK1 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O1:K1 / APEC GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|B7MHW4|DAPE_ECO45 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|A4XWV4|DAPE_PSEMY Succinyl-diaminopimelate desuccinylase OS=Pseudomonas mendocina (strain ymp) GN=dapE PE=3 SV=1 37 234 1.0E-09
sp|A4VMY9|DAPE_PSEU5 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas stutzeri (strain A1501) GN=dapE PE=3 SV=1 34 234 1.0E-09
sp|Q7VNB3|DAPE_HAEDU Succinyl-diaminopimelate desuccinylase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dapE PE=3 SV=1 33 234 1.0E-09
sp|Q32D98|DAPE_SHIDS Succinyl-diaminopimelate desuccinylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dapE PE=3 SV=1 36 274 1.0E-09
sp|P44514|DAPE_HAEIN Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dapE PE=1 SV=1 33 287 1.0E-09
sp|Q3IL20|DAPE_PSEHT Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dapE PE=3 SV=1 34 310 1.0E-09
sp|B0TVI4|DAPE_SHEHH Succinyl-diaminopimelate desuccinylase OS=Shewanella halifaxensis (strain HAW-EB4) GN=dapE PE=3 SV=1 34 309 1.0E-09
sp|A4WD51|DAPE_ENT38 Succinyl-diaminopimelate desuccinylase OS=Enterobacter sp. (strain 638) GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|B5Z008|DAPE_ECO5E Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|Q8XBE0|DAPE_ECO57 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O157:H7 GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|P0AED8|DAPE_SHIFL Succinyl-diaminopimelate desuccinylase OS=Shigella flexneri GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|Q31Y20|DAPE_SHIBS Succinyl-diaminopimelate desuccinylase OS=Shigella boydii serotype 4 (strain Sb227) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B1LNC1|DAPE_ECOSM Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|P0AED7|DAPE_ECOLI Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12) GN=dapE PE=1 SV=1 36 289 2.0E-09
sp|B1IWI8|DAPE_ECOLC Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|A8A2W3|DAPE_ECOHS Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O9:H4 (strain HS) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B1XAE3|DAPE_ECODH Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12 / DH10B) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|C4ZX46|DAPE_ECOBW Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B7M7H2|DAPE_ECO8A Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O8 (strain IAI1) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B7LCK7|DAPE_ECO55 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain 55989 / EAEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B7UGM1|DAPE_ECO27 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|A7ZPR5|DAPE_ECO24 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B2TXP7|DAPE_SHIB3 Succinyl-diaminopimelate desuccinylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|O59402|LYSK_PYRHO N-acetyl-lysine deacetylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=lysK PE=3 SV=1 34 226 2.0E-09
sp|Q886Q4|DAPE_PSESM Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dapE PE=3 SV=1 28 310 2.0E-09
sp|Q3YZ81|DAPE_SHISS Succinyl-diaminopimelate desuccinylase OS=Shigella sonnei (strain Ss046) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|A5UB44|DAPE_HAEIE Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain PittEE) GN=dapE PE=3 SV=1 33 234 2.0E-09
sp|B6I539|DAPE_ECOSE Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain SE11) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|C3LRV6|ARGE_VIBCM Acetylornithine deacetylase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=argE PE=3 SV=1 50 383 2.0E-09
sp|Q9KNT5|ARGE_VIBCH Acetylornithine deacetylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argE PE=3 SV=1 50 383 2.0E-09
sp|A5F4Z7|ARGE_VIBC3 Acetylornithine deacetylase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=argE PE=3 SV=1 50 383 2.0E-09
sp|A1JL17|DAPE_YERE8 Succinyl-diaminopimelate desuccinylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dapE PE=3 SV=1 36 310 2.0E-09
sp|Q0ASJ5|DAPE_MARMM Succinyl-diaminopimelate desuccinylase OS=Maricaulis maris (strain MCS10) GN=dapE PE=3 SV=1 37 229 2.0E-09
sp|Q65US9|DAPE_MANSM Succinyl-diaminopimelate desuccinylase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dapE PE=3 SV=1 33 287 2.0E-09
sp|B7LKH0|DAPE_ESCF3 Succinyl-diaminopimelate desuccinylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|A8ADB6|DAPE_CITK8 Succinyl-diaminopimelate desuccinylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dapE PE=3 SV=1 36 310 2.0E-09
sp|A7FG57|DAPE_YERP3 Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dapE PE=3 SV=1 36 310 2.0E-09
sp|B7NQK9|DAPE_ECO7I Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|Q11LD2|DAPE_CHESB Succinyl-diaminopimelate desuccinylase OS=Chelativorans sp. (strain BNC1) GN=dapE PE=3 SV=1 42 287 2.0E-09
sp|B5ZN23|DAPE_RHILW Succinyl-diaminopimelate desuccinylase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dapE PE=3 SV=1 41 287 3.0E-09
sp|B7N653|DAPE_ECOLU Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dapE PE=3 SV=1 36 289 3.0E-09
sp|A0L3N2|DAPE_MAGMM Succinyl-diaminopimelate desuccinylase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dapE PE=3 SV=2 37 290 3.0E-09
sp|Q9K4Z7|ARGE_MORPR Acetylornithine deacetylase OS=Moritella profunda GN=argE PE=1 SV=1 38 390 3.0E-09
sp|Q4FNF5|DAPE_PELUB Succinyl-diaminopimelate desuccinylase OS=Pelagibacter ubique (strain HTCC1062) GN=dapE PE=3 SV=1 30 287 3.0E-09
sp|Q2RNM1|DAPE_RHORT Succinyl-diaminopimelate desuccinylase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=dapE PE=3 SV=2 37 287 4.0E-09
sp|A6VUR6|DAPE_MARMS Succinyl-diaminopimelate desuccinylase OS=Marinomonas sp. (strain MWYL1) GN=dapE PE=3 SV=2 34 310 4.0E-09
sp|B2VE50|DAPE_ERWT9 Succinyl-diaminopimelate desuccinylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dapE PE=3 SV=1 36 310 4.0E-09
sp|Q0T246|DAPE_SHIF8 Succinyl-diaminopimelate desuccinylase OS=Shigella flexneri serotype 5b (strain 8401) GN=dapE PE=3 SV=1 36 289 4.0E-09
sp|Q8KA25|DAPE_BUCAP Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dapE PE=3 SV=1 36 298 5.0E-09
sp|B1Y6E7|DAPE_LEPCP Succinyl-diaminopimelate desuccinylase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dapE PE=3 SV=1 37 323 5.0E-09
sp|Q083F0|DAPE_SHEFN Succinyl-diaminopimelate desuccinylase OS=Shewanella frigidimarina (strain NCIMB 400) GN=dapE PE=3 SV=1 34 309 5.0E-09
sp|A4YLC3|DAPE_BRASO Succinyl-diaminopimelate desuccinylase OS=Bradyrhizobium sp. (strain ORS278) GN=dapE PE=3 SV=1 34 287 5.0E-09
sp|A8H424|DAPE_SHEPA Succinyl-diaminopimelate desuccinylase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dapE PE=3 SV=1 33 309 6.0E-09
sp|B1JSH5|DAPE_YERPY Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q668G5|DAPE_YERPS Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|A4TMM3|DAPE_YERPP Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis (strain Pestoides F) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q1CK18|DAPE_YERPN Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|A9R2H7|DAPE_YERPG Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q7CJI9|DAPE_YERPE Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|B2K985|DAPE_YERPB Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q1C5R3|DAPE_YERPA Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q21HG2|DAPE_SACD2 Succinyl-diaminopimelate desuccinylase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dapE PE=3 SV=1 31 310 6.0E-09
sp|A7MY37|DAPE_VIBCB Succinyl-diaminopimelate desuccinylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dapE PE=3 SV=1 34 310 6.0E-09
sp|A4SYV9|DAPE_POLSQ Succinyl-diaminopimelate desuccinylase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=dapE PE=3 SV=1 34 308 7.0E-09
sp|Q6NC49|DAPE_RHOPA Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dapE PE=3 SV=1 27 287 7.0E-09
sp|Q2KD47|DAPE_RHIEC Succinyl-diaminopimelate desuccinylase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dapE PE=3 SV=2 41 287 7.0E-09
sp|Q9K4Z2|ARGE_MORAB Acetylornithine deacetylase OS=Moritella abyssi GN=argE PE=1 SV=1 38 390 7.0E-09
sp|A5WD56|DAPE_PSYWF Succinyl-diaminopimelate desuccinylase OS=Psychrobacter sp. (strain PRwf-1) GN=dapE PE=3 SV=1 26 310 7.0E-09
sp|B3QCH4|DAPE_RHOPT Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain TIE-1) GN=dapE PE=3 SV=1 27 287 8.0E-09
sp|Q48F49|DAPE_PSE14 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dapE PE=3 SV=1 28 310 9.0E-09
sp|B4RDU4|DAPE_PHEZH Succinyl-diaminopimelate desuccinylase OS=Phenylobacterium zucineum (strain HLK1) GN=dapE PE=3 SV=1 37 287 9.0E-09
sp|A6Q7J0|DAPE_SULNB Succinyl-diaminopimelate desuccinylase OS=Sulfurovum sp. (strain NBC37-1) GN=dapE PE=3 SV=1 36 271 1.0E-08
sp|B8CMP0|DAPE_SHEPW Succinyl-diaminopimelate desuccinylase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dapE PE=3 SV=1 34 309 1.0E-08
sp|A1AVU9|DAPE_RUTMC Succinyl-diaminopimelate desuccinylase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dapE PE=3 SV=1 34 290 1.0E-08
sp|Q4KHI7|DAPE_PSEF5 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dapE PE=3 SV=1 31 234 1.0E-08
sp|A3QE30|DAPE1_SHELP Succinyl-diaminopimelate desuccinylase 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dapE1 PE=3 SV=1 34 309 1.0E-08
sp|A1WX26|DAPE_HALHL Succinyl-diaminopimelate desuccinylase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dapE PE=3 SV=1 34 310 1.0E-08
sp|A1K719|DAPE_AZOSB Succinyl-diaminopimelate desuccinylase OS=Azoarcus sp. (strain BH72) GN=dapE PE=3 SV=1 37 234 1.0E-08
sp|B2JID9|DAPE_BURP8 Succinyl-diaminopimelate desuccinylase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dapE PE=3 SV=1 106 390 1.0E-08
sp|B8EA23|DAPE_SHEB2 Succinyl-diaminopimelate desuccinylase OS=Shewanella baltica (strain OS223) GN=dapE PE=3 SV=2 30 276 2.0E-08
sp|A6TC94|DAPE_KLEP7 Succinyl-diaminopimelate desuccinylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dapE PE=3 SV=1 36 289 2.0E-08
sp|Q0KA02|DAPE_CUPNH Succinyl-diaminopimelate desuccinylase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dapE PE=3 SV=1 37 310 2.0E-08
sp|A9NCE9|DAPE_COXBR Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|B5XVN4|DAPE_KLEP3 Succinyl-diaminopimelate desuccinylase OS=Klebsiella pneumoniae (strain 342) GN=dapE PE=3 SV=1 36 289 2.0E-08
sp|B1KDS3|DAPE_SHEWM Succinyl-diaminopimelate desuccinylase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dapE PE=3 SV=1 34 309 2.0E-08
sp|Q83DN2|DAPE_COXBU Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|A9KC82|DAPE_COXBN Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|B6J120|DAPE_COXB2 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuG_Q212) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|B6J929|DAPE_COXB1 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuK_Q154) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|Q2SBP0|DAPE_HAHCH Succinyl-diaminopimelate desuccinylase OS=Hahella chejuensis (strain KCTC 2396) GN=dapE PE=3 SV=1 34 310 2.0E-08
sp|A5ESQ3|DAPE_BRASB Succinyl-diaminopimelate desuccinylase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=dapE PE=3 SV=1 34 287 2.0E-08
sp|B3R2D1|DAPE_CUPTR Succinyl-diaminopimelate desuccinylase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dapE PE=3 SV=1 37 310 2.0E-08
sp|Q12N78|DAPE_SHEDO Succinyl-diaminopimelate desuccinylase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dapE PE=3 SV=1 34 287 2.0E-08
sp|Q6D7N4|DAPE_PECAS Succinyl-diaminopimelate desuccinylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dapE PE=3 SV=1 36 310 2.0E-08
sp|A8GHK9|DAPE_SERP5 Succinyl-diaminopimelate desuccinylase OS=Serratia proteamaculans (strain 568) GN=dapE PE=3 SV=1 36 310 2.0E-08
sp|Q058B2|DAPE_BUCCC Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapE PE=3 SV=1 34 231 3.0E-08
sp|Q470C3|DAPE_CUPPJ Succinyl-diaminopimelate desuccinylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dapE PE=3 SV=1 37 310 3.0E-08
sp|Q8ZN75|DAPE_SALTY Succinyl-diaminopimelate desuccinylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dapE PE=1 SV=1 36 310 3.0E-08
sp|B4TR55|DAPE_SALSV Succinyl-diaminopimelate desuccinylase OS=Salmonella schwarzengrund (strain CVM19633) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|A9N2Z9|DAPE_SALPB Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B4T0L0|DAPE_SALNS Succinyl-diaminopimelate desuccinylase OS=Salmonella newport (strain SL254) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B4TD58|DAPE_SALHS Succinyl-diaminopimelate desuccinylase OS=Salmonella heidelberg (strain SL476) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B5RCV3|DAPE_SALG2 Succinyl-diaminopimelate desuccinylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B5R4J0|DAPE_SALEP Succinyl-diaminopimelate desuccinylase OS=Salmonella enteritidis PT4 (strain P125109) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B5FQH3|DAPE_SALDC Succinyl-diaminopimelate desuccinylase OS=Salmonella dublin (strain CT_02021853) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|A9MHQ8|DAPE_SALAR Succinyl-diaminopimelate desuccinylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|Q8U0B3|LYSK_PYRFU N-acetyl-lysine deacetylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=lysK PE=3 SV=1 34 218 3.0E-08
sp|A9CKC4|DAPE_AGRFC Succinyl-diaminopimelate desuccinylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dapE PE=3 SV=1 42 287 3.0E-08
sp|B5BB22|DAPE_SALPK Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi A (strain AKU_12601) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|C0PYS5|DAPE_SALPC Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi C (strain RKS4594) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|Q5PLR5|DAPE_SALPA Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|Q57LM8|DAPE_SALCH Succinyl-diaminopimelate desuccinylase OS=Salmonella choleraesuis (strain SC-B67) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B0KS83|DAPE_PSEPG Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain GB-1) GN=dapE PE=3 SV=1 28 310 3.0E-08
sp|A0KIB5|DAPE_AERHH Succinyl-diaminopimelate desuccinylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dapE PE=3 SV=1 34 310 3.0E-08
sp|Q6LTW8|DAPE_PHOPR Succinyl-diaminopimelate desuccinylase OS=Photobacterium profundum GN=dapE PE=3 SV=1 34 309 4.0E-08
sp|B1JBS2|DAPE_PSEPW Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain W619) GN=dapE PE=3 SV=1 28 234 4.0E-08
sp|Q88MP5|DAPE_PSEPK Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain KT2440) GN=dapE PE=3 SV=1 28 310 4.0E-08
sp|A5W863|DAPE_PSEP1 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dapE PE=3 SV=1 28 310 4.0E-08
sp|A7ZFC1|DAPE_CAMC1 Succinyl-diaminopimelate desuccinylase OS=Campylobacter concisus (strain 13826) GN=dapE PE=3 SV=1 106 287 4.0E-08
sp|A3D547|DAPE_SHEB5 Succinyl-diaminopimelate desuccinylase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dapE PE=3 SV=2 30 276 4.0E-08
sp|B1XTT6|DAPE_POLNS Succinyl-diaminopimelate desuccinylase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=dapE PE=3 SV=1 34 295 4.0E-08
sp|B5F0L0|DAPE_SALA4 Succinyl-diaminopimelate desuccinylase OS=Salmonella agona (strain SL483) GN=dapE PE=3 SV=1 36 310 5.0E-08
sp|Q8Z4S2|DAPE_SALTI Succinyl-diaminopimelate desuccinylase OS=Salmonella typhi GN=dapE PE=3 SV=1 36 310 5.0E-08
sp|Q4FU86|DAPE_PSYA2 Succinyl-diaminopimelate desuccinylase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dapE PE=3 SV=1 35 304 5.0E-08
sp|A9L3M8|DAPE_SHEB9 Succinyl-diaminopimelate desuccinylase OS=Shewanella baltica (strain OS195) GN=dapE PE=3 SV=2 30 276 5.0E-08
sp|B9JZL9|DAPE_AGRVS Succinyl-diaminopimelate desuccinylase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dapE PE=3 SV=1 41 287 5.0E-08
sp|A6WNV3|DAPE_SHEB8 Succinyl-diaminopimelate desuccinylase OS=Shewanella baltica (strain OS185) GN=dapE PE=3 SV=1 30 276 5.0E-08
sp|Q9RUH3|LYSK_DEIRA N-acetyl-lysine deacetylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lysK PE=3 SV=1 39 226 6.0E-08
sp|Q13F22|DAPE_RHOPS Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisB5) GN=dapE PE=3 SV=1 35 298 6.0E-08
sp|Q6FE14|DAPE_ACIAD Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dapE PE=3 SV=1 33 310 7.0E-08
sp|Q4ZWU0|DAPE_PSEU2 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dapE PE=3 SV=1 28 310 9.0E-08
sp|Q5HC82|DAPE_EHRRW Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Welgevonden) GN=dapE PE=3 SV=1 37 287 1.0E-07
sp|A8F303|DAPE_RICM5 Succinyl-diaminopimelate desuccinylase OS=Rickettsia massiliae (strain Mtu5) GN=dapE PE=3 SV=2 41 257 1.0E-07
sp|A8GQ98|DAPE_RICAH Succinyl-diaminopimelate desuccinylase OS=Rickettsia akari (strain Hartford) GN=dapE PE=3 SV=2 41 314 1.0E-07
sp|A8IMH3|DAPE_AZOC5 Succinyl-diaminopimelate desuccinylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dapE PE=3 SV=2 37 287 1.0E-07
sp|C4K2X8|DAPE_RICPU Succinyl-diaminopimelate desuccinylase OS=Rickettsia peacockii (strain Rustic) GN=dapE PE=3 SV=1 41 257 1.0E-07
sp|Q92FY0|DAPE_RICCN Succinyl-diaminopimelate desuccinylase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dapE PE=3 SV=2 41 257 1.0E-07
sp|C3PM12|DAPE_RICAE Succinyl-diaminopimelate desuccinylase OS=Rickettsia africae (strain ESF-5) GN=dapE PE=3 SV=1 41 257 1.0E-07
sp|Q47Z95|DAPE_COLP3 Succinyl-diaminopimelate desuccinylase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dapE PE=3 SV=1 33 229 2.0E-07
sp|Q3SN25|DAPE_NITWN Succinyl-diaminopimelate desuccinylase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dapE PE=3 SV=1 34 287 2.0E-07
sp|Q5FFA0|DAPE_EHRRG Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Gardel) GN=dapE PE=3 SV=1 37 287 2.0E-07
sp|Q1I614|DAPE_PSEE4 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas entomophila (strain L48) GN=dapE PE=3 SV=1 28 310 2.0E-07
sp|Q1QH74|DAPE_NITHX Succinyl-diaminopimelate desuccinylase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dapE PE=3 SV=2 34 287 2.0E-07
sp|C4LDG0|DAPE_TOLAT Succinyl-diaminopimelate desuccinylase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dapE PE=3 SV=1 34 309 2.0E-07
sp|Q89BP2|DAPE_BRADU Succinyl-diaminopimelate desuccinylase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dapE PE=3 SV=1 34 287 2.0E-07
sp|B3H2U3|DAPE_ACTP7 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dapE PE=3 SV=1 33 287 2.0E-07
sp|A3N3G9|DAPE_ACTP2 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dapE PE=3 SV=1 33 287 2.0E-07
sp|A6U5J1|DAPE_SINMW Succinyl-diaminopimelate desuccinylase OS=Sinorhizobium medicae (strain WSM419) GN=dapE PE=3 SV=2 42 287 3.0E-07
sp|A6VMI0|DAPE_ACTSZ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dapE PE=3 SV=1 33 287 3.0E-07
sp|Q3KHC5|DAPE_PSEPF Succinyl-diaminopimelate desuccinylase OS=Pseudomonas fluorescens (strain Pf0-1) GN=dapE PE=3 SV=1 34 234 3.0E-07
sp|Q8EEB6|DAPE_SHEON Succinyl-diaminopimelate desuccinylase OS=Shewanella oneidensis (strain MR-1) GN=dapE PE=3 SV=1 38 276 3.0E-07
sp|Q0HUU6|DAPE_SHESR Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain MR-7) GN=dapE PE=3 SV=1 38 338 3.0E-07
sp|Q0HJ36|DAPE_SHESM Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain MR-4) GN=dapE PE=3 SV=1 38 338 3.0E-07
sp|Q5GS68|DAPE_WOLTR Succinyl-diaminopimelate desuccinylase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dapE PE=3 SV=1 37 296 4.0E-07
sp|Q47FB0|DAPE_DECAR Succinyl-diaminopimelate desuccinylase OS=Dechloromonas aromatica (strain RCB) GN=dapE PE=3 SV=1 37 298 4.0E-07
sp|P54542|YQJE_BACSU Uncharacterized protein YqjE OS=Bacillus subtilis (strain 168) GN=yqjE PE=3 SV=2 36 282 6.0E-07
sp|A4Y7B1|DAPE_SHEPC Succinyl-diaminopimelate desuccinylase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dapE PE=3 SV=1 38 276 8.0E-07
sp|B1M6P0|DAPE_METRJ Succinyl-diaminopimelate desuccinylase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dapE PE=3 SV=1 37 306 8.0E-07
sp|A1RJ78|DAPE_SHESW Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain W3-18-1) GN=dapE PE=3 SV=1 38 276 8.0E-07
sp|Q1QDC1|DAPE_PSYCK Succinyl-diaminopimelate desuccinylase OS=Psychrobacter cryohalolentis (strain K5) GN=dapE PE=3 SV=1 25 304 8.0E-07
sp|B9J8D0|DAPE_AGRRK Succinyl-diaminopimelate desuccinylase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dapE PE=3 SV=1 41 287 8.0E-07
sp|Q21B56|DAPE_RHOPB Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisB18) GN=dapE PE=3 SV=1 30 287 9.0E-07
sp|A0KWH4|DAPE_SHESA Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain ANA-3) GN=dapE PE=3 SV=1 38 338 9.0E-07
sp|B9KP62|DAPE_RHOSK Succinyl-diaminopimelate desuccinylase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=dapE PE=3 SV=1 37 301 1.0E-06
sp|Q3IYS2|DAPE_RHOS4 Succinyl-diaminopimelate desuccinylase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dapE PE=3 SV=1 37 301 1.0E-06
sp|A8F095|DAPE_RICCK Succinyl-diaminopimelate desuccinylase OS=Rickettsia canadensis (strain McKiel) GN=dapE PE=3 SV=1 41 261 1.0E-06
sp|A3PNH5|DAPE_RHOS1 Succinyl-diaminopimelate desuccinylase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dapE PE=3 SV=1 37 308 1.0E-06
sp|B3CLN1|DAPE_WOLPP Succinyl-diaminopimelate desuccinylase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dapE PE=3 SV=1 37 257 1.0E-06
sp|Q8ZUG2|LYSK_PYRAE N-acetyl-lysine deacetylase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=lysK PE=3 SV=1 38 387 2.0E-06
sp|B0VRY3|DAPE_ACIBS Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain SDF) GN=dapE PE=3 SV=1 85 310 2.0E-06
sp|B6JJP4|DAPE_OLICO Succinyl-diaminopimelate desuccinylase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dapE PE=3 SV=1 34 287 2.0E-06
sp|Q92SH1|DAPE_RHIME Succinyl-diaminopimelate desuccinylase OS=Rhizobium meliloti (strain 1021) GN=dapE PE=3 SV=1 85 287 2.0E-06
sp|Q98D57|DAPE_RHILO Succinyl-diaminopimelate desuccinylase OS=Rhizobium loti (strain MAFF303099) GN=dapE PE=3 SV=1 42 287 2.0E-06
sp|Q608D9|DAPE_METCA Succinyl-diaminopimelate desuccinylase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dapE PE=3 SV=1 34 310 3.0E-06
sp|Q07TX3|DAPE_RHOP5 Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisA53) GN=dapE PE=3 SV=1 37 287 3.0E-06
sp|B4ECP3|DAPE_BURCJ Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dapE PE=3 SV=1 34 310 4.0E-06
sp|Q5NYT7|DAPE_AROAE Succinyl-diaminopimelate desuccinylase OS=Aromatoleum aromaticum (strain EbN1) GN=dapE PE=3 SV=1 37 310 4.0E-06
sp|A7I005|DAPE_CAMHC Succinyl-diaminopimelate desuccinylase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dapE PE=3 SV=1 100 242 4.0E-06
sp|A9AHS8|DAPE_BURM1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dapE PE=3 SV=1 34 310 5.0E-06
sp|A7HPQ6|DAPE_PARL1 Succinyl-diaminopimelate desuccinylase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dapE PE=3 SV=1 23 314 6.0E-06
sp|B8ELJ6|DAPE_METSB Succinyl-diaminopimelate desuccinylase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dapE PE=3 SV=1 37 288 7.0E-06
sp|B0V4V8|DAPE_ACIBY Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AYE) GN=dapE PE=3 SV=1 85 310 8.0E-06
sp|B7I842|DAPE_ACIB5 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB0057) GN=dapE PE=3 SV=1 85 310 8.0E-06
sp|A3M8H2|DAPE_ACIBT Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dapE PE=3 SV=2 85 310 8.0E-06
sp|A4JF88|DAPE_BURVG Succinyl-diaminopimelate desuccinylase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dapE PE=3 SV=1 106 310 8.0E-06
sp|B7GXA3|DAPE_ACIB3 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB307-0294) GN=dapE PE=3 SV=1 85 310 8.0E-06
sp|B2HY23|DAPE_ACIBC Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ACICU) GN=dapE PE=3 SV=1 85 310 8.0E-06
sp|B8GPR9|DAPE_THISH Succinyl-diaminopimelate desuccinylase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dapE PE=3 SV=1 34 309 9.0E-06
sp|B3PBB9|DAPE_CELJU Succinyl-diaminopimelate desuccinylase OS=Cellvibrio japonicus (strain Ueda107) GN=dapE PE=3 SV=2 38 310 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 53.43 28.51 78.35
CcL In ants, during behavior modification 61.71 33.33 90.10
CcD In ants, recently dead 71.08 38.92 103.24

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.578147 no
SC16a CcD 0.220899 no
CcL CcD 0.571223 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1789
MRFPILTAIHALPLIASAAQRPLISSSSTPAYRSELLSLHRSLVSIESISGNEAAVGRFLESYLSGRGYTVTRQH
VGAAKDDRFNLLARPGDDNQSRRPRVVVTSHIDVVPPYIPYGISDDDEKINTDTIITGRGSVDAKGSVAAMVVAL
EQLRAAQTISDADAALVFVVGEEVNGDGMRTYARSLGSDGLPPAVIFGEPTENKLACGHKGILNCRVSARGTSGH
SGYPWLGKSANAVMVRAMAALLDADLGSSARFGNSTVNIGRFEGGVAANVIAENATVELAVRVAAGSEEDGAKLA
RRGIQSVLDRVDDEALTMNCVGGYGPVKCNCDVTGFDTVIVNYGTDIGNLKGNYTKYLYGPGSILVAHGARENLT
VGHLETAVEGYKNLILHALS
Coding >Ophio5|1789
ATGCGCTTCCCAATTCTCACCGCCATACACGCTCTGCCGCTAATCGCCAGCGCCGCGCAACGTCCCCTCATCAGC
TCATCATCGACGCCCGCCTACCGAAGCGAGCTGCTCAGCCTGCACCGCTCGCTCGTCTCCATCGAGTCCATCAGC
GGAAATGAGGCCGCCGTCGGACGCTTCCTTGAGAGCTACCTCTCTGGACGGGGCTATACCGTGACGAGACAGCAT
GTGGGCGCCGCCAAGGATGATCGCTTCAACCTCCTGGCGCGTCCCGGTGATGATAACCAAAGCAGGAGGCCGAGG
GTGGTGGTGACGAGTCACATCGACGTTGTACCGCCATACATCCCCTACGGCATCTCCGATGACGATGAAAAAATC
AATACCGATACCATCATCACGGGGCGCGGCTCCGTAGACGCCAAAGGCAGCGTCGCTGCCATGGTCGTCGCGCTG
GAGCAACTCCGTGCAGCACAAACCATCTCCGACGCTGACGCCGCCCTGGTTTTTGTCGTGGGCGAGGAAGTCAAT
GGCGACGGCATGCGTACCTACGCCCGCTCCCTAGGCTCCGACGGTCTGCCGCCCGCCGTCATCTTCGGCGAGCCG
ACGGAGAACAAGCTGGCGTGCGGCCACAAGGGCATACTGAACTGCCGCGTCTCTGCGCGCGGAACGTCCGGCCAT
AGCGGCTATCCCTGGCTGGGCAAATCGGCCAACGCTGTCATGGTGCGCGCCATGGCTGCCTTGCTTGACGCTGAC
CTTGGCTCCTCGGCCCGCTTCGGCAATTCAACCGTCAACATCGGCCGCTTCGAAGGCGGCGTCGCTGCCAACGTC
ATCGCCGAGAACGCCACCGTCGAGCTGGCTGTTCGCGTCGCCGCCGGCTCAGAGGAAGACGGTGCAAAATTGGCG
CGGCGTGGTATCCAGTCGGTGCTCGACCGTGTCGACGATGAGGCTTTGACTATGAATTGCGTTGGGGGCTACGGA
CCCGTCAAGTGTAACTGCGATGTGACCGGCTTCGACACCGTCATCGTCAACTACGGAACCGACATCGGTAACCTC
AAGGGCAACTACACCAAATACCTCTACGGCCCAGGGTCCATCCTCGTGGCGCATGGCGCGCGGGAGAATCTGACC
GTCGGCCATCTCGAGACCGCCGTCGAGGGTTACAAGAACCTTATCCTGCACGCCCTGTCG
Transcript >Ophio5|1789
ATGCGCTTCCCAATTCTCACCGCCATACACGCTCTGCCGCTAATCGCCAGCGCCGCGCAACGTCCCCTCATCAGC
TCATCATCGACGCCCGCCTACCGAAGCGAGCTGCTCAGCCTGCACCGCTCGCTCGTCTCCATCGAGTCCATCAGC
GGAAATGAGGCCGCCGTCGGACGCTTCCTTGAGAGCTACCTCTCTGGACGGGGCTATACCGTGACGAGACAGCAT
GTGGGCGCCGCCAAGGATGATCGCTTCAACCTCCTGGCGCGTCCCGGTGATGATAACCAAAGCAGGAGGCCGAGG
GTGGTGGTGACGAGTCACATCGACGTTGTACCGCCATACATCCCCTACGGCATCTCCGATGACGATGAAAAAATC
AATACCGATACCATCATCACGGGGCGCGGCTCCGTAGACGCCAAAGGCAGCGTCGCTGCCATGGTCGTCGCGCTG
GAGCAACTCCGTGCAGCACAAACCATCTCCGACGCTGACGCCGCCCTGGTTTTTGTCGTGGGCGAGGAAGTCAAT
GGCGACGGCATGCGTACCTACGCCCGCTCCCTAGGCTCCGACGGTCTGCCGCCCGCCGTCATCTTCGGCGAGCCG
ACGGAGAACAAGCTGGCGTGCGGCCACAAGGGCATACTGAACTGCCGCGTCTCTGCGCGCGGAACGTCCGGCCAT
AGCGGCTATCCCTGGCTGGGCAAATCGGCCAACGCTGTCATGGTGCGCGCCATGGCTGCCTTGCTTGACGCTGAC
CTTGGCTCCTCGGCCCGCTTCGGCAATTCAACCGTCAACATCGGCCGCTTCGAAGGCGGCGTCGCTGCCAACGTC
ATCGCCGAGAACGCCACCGTCGAGCTGGCTGTTCGCGTCGCCGCCGGCTCAGAGGAAGACGGTGCAAAATTGGCG
CGGCGTGGTATCCAGTCGGTGCTCGACCGTGTCGACGATGAGGCTTTGACTATGAATTGCGTTGGGGGCTACGGA
CCCGTCAAGTGTAACTGCGATGTGACCGGCTTCGACACCGTCATCGTCAACTACGGAACCGACATCGGTAACCTC
AAGGGCAACTACACCAAATACCTCTACGGCCCAGGGTCCATCCTCGTGGCGCATGGCGCGCGGGAGAATCTGACC
GTCGGCCATCTCGAGACCGCCGTCGAGGGTTACAAGAACCTTATCCTGCACGCCCTGTCGTAG
Gene >Ophio5|1789
ATGCGCTTCCCAATTCTCACCGCCATACACGCTCTGCCGCTAATCGCCAGCGCCGCGCAACGTCCCCTCATCAGC
TCATCATCGACGCCCGCCTACCGAAGCGAGCTGCTCAGCCTGCACCGCTCGCTCGTCTCCATCGAGTCCATCAGC
GGAAATGAGGCCGCCGTCGGACGCTTCCTTGAGAGCTACCTCTCTGGACGGGGCTATACCGTGACGAGACAGCAT
GTGGGCGCCGCCAAGGATGATCGCTTCAACCTCCTGGCGCGTCCCGGTGATGATAACCAAAGCAGGAGGCCGAGG
GTGGTGGTGACGAGTCACATCGACGTTGTACCGCCATACATCCCCTACGGCATCTCCGATGACGATGAAAAAATC
AATACCGATACCATCATCACGGGGCGCGGCTCCGTAGACGCCAAAGGCAGCGTCGCTGCCATGGTCGTCGCGCTG
GAGCAACTCCGTGCAGCACAAACCATCTCCGACGCTGACGCCGCCCTGGTTTTTGTCGTGGGCGAGGAAGTCAAT
GGCGACGGCATGCGTACCTACGCCCGCTCCCTAGGCTCCGACGGTCTGCCGCCCGCCGTCATCTTCGGCGAGCCG
ACGGAGAACAAGCTGGCGTGCGGCCACAAGGGCATACTGAACTGCCGCGTCTCTGCGCGCGGAACGTCCGGCCAT
AGCGGCTATCCCTGGCTGGGCAAATCGGCCAACGCTGTCATGGTGCGCGCCATGGCTGCCTTGCTTGACGCTGAC
CTTGGCTCCTCGGCCCGCTTCGGCAATTCAACCGTCAACATCGGCCGCTTCGAAGGCGGCGTCGCTGCCAACGTC
ATCGCCGAGAACGCCACCGTCGAGCTGGCTGTTCGCGTCGCCGCCGGCTCAGAGGAAGACGGTGCAAAATTGGCG
CGGCGTGGTATCCAGTCGGTGCTCGACCGTGTCGACGATGAGGCTTTGACTATGAATTGCGTTGGGGGCTACGGA
CCCGTCAAGTGTAACTGCGATGTGACCGGTGAGGGAGGCATTTATAGAGGCATCCTCCTCCCCGTTCAGGTTCTC
CTGCTGACCACGAGGGCTCCCCACCGCCAGGCTTCGACACCGTCATCGTCAACTACGGAACCGACATCGGTAACC
TCAAGGGCAACTACACCAAATACCTCTACGGCCCAGGGTCCATCCTCGTGGCGCATGGCGCGCGGGAGAATCTGA
CCGTCGGCCATCTCGAGACCGCCGTCGAGGGTTACAAGAACCTTATCCTGCACGCCCTGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail