Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1789
Gene name
Locationscaffold_168:28137..29402
Strand-
Gene length (bp)1265
Transcript length (bp)1188
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07687 M20_dimer Peptidase dimerisation domain 2.3E-18 208 295
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 1.0E-15 103 391

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CI30|Y3666_SORMK Peptidase M20 domain-containing protein SMAC_03666.2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_03666.2 PE=3 SV=2 13 394 5.0E-140
sp|Q4WNC9|P20D1_ASPFU Probable carboxypeptidase AFUA_6G06800 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G06800 PE=3 SV=1 34 394 8.0E-99
sp|B0Y766|P20D1_ASPFC Probable carboxypeptidase AFUB_072730 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_072730 PE=3 SV=1 34 394 8.0E-99
sp|A1DM79|P20D1_NEOFI Probable carboxypeptidase NFIA_052450 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_052450 PE=3 SV=1 34 394 1.0E-96
sp|A2RBC2|P20D1_ASPNC Probable carboxypeptidase An18g06210 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g06210 PE=3 SV=1 34 390 2.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CI30|Y3666_SORMK Peptidase M20 domain-containing protein SMAC_03666.2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_03666.2 PE=3 SV=2 13 394 5.0E-140
sp|Q4WNC9|P20D1_ASPFU Probable carboxypeptidase AFUA_6G06800 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G06800 PE=3 SV=1 34 394 8.0E-99
sp|B0Y766|P20D1_ASPFC Probable carboxypeptidase AFUB_072730 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_072730 PE=3 SV=1 34 394 8.0E-99
sp|A1DM79|P20D1_NEOFI Probable carboxypeptidase NFIA_052450 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_052450 PE=3 SV=1 34 394 1.0E-96
sp|A2RBC2|P20D1_ASPNC Probable carboxypeptidase An18g06210 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g06210 PE=3 SV=1 34 390 2.0E-95
sp|Q2UMC1|P20D2_ASPOR Probable carboxypeptidase AO090003000058 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090003000058 PE=3 SV=1 22 394 5.0E-95
sp|B8N4P0|P20D2_ASPFN Probable carboxypeptidase AFLA_037450 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_037450 PE=3 SV=1 22 394 8.0E-95
sp|E4UW91|P20D1_ARTGP Probable carboxypeptidase MGYG_04702 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_04702 PE=3 SV=1 34 393 2.0E-90
sp|Q5B131|P20D1_EMENI Probable carboxypeptidase AN5749 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5749 PE=3 SV=1 1 394 5.0E-90
sp|C4JXT1|P20D1_UNCRE Probable carboxypeptidase UREG_07869 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07869 PE=3 SV=1 1 390 1.0E-89
sp|C5FXY7|P20D1_ARTOC Probable carboxypeptidase MCYG_07204 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07204 PE=3 SV=1 34 394 4.0E-89
sp|E9DG92|P20D1_COCPS Probable carboxypeptidase CPSG_08841 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_08841 PE=3 SV=1 34 390 6.0E-89
sp|D4AXX2|P20D1_ARTBC Probable carboxypeptidase ARB_01041 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01041 PE=3 SV=1 34 393 8.0E-89
sp|D4D6R4|P20D1_TRIVH Probable carboxypeptidase TRV_02791 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02791 PE=3 SV=1 34 393 2.0E-88
sp|C5PE42|P20D1_COCP7 Probable carboxypeptidase CPC735_001200 OS=Coccidioides posadasii (strain C735) GN=CPC735_001200 PE=3 SV=1 34 390 2.0E-88
sp|C0S1J6|P20D1_PARBP Probable carboxypeptidase PABG_01461 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_01461 PE=3 SV=1 4 390 8.0E-87
sp|A1CAX3|P20D2_ASPCL Probable carboxypeptidase ACLA_013260 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_013260 PE=3 SV=1 1 395 1.0E-86
sp|Q0CTS9|P20D1_ASPTN Probable carboxypeptidase ATEG_02905 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_02905 PE=3 SV=1 34 394 2.0E-86
sp|C1G9X6|P20D1_PARBD Probable carboxypeptidase PADG_04062 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_04062 PE=3 SV=1 4 390 2.0E-86
sp|B6QHD2|P20D1_TALMQ Probable carboxypeptidase PMAA_093910 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_093910 PE=3 SV=1 34 394 3.0E-85
sp|C0NAB3|P20D1_AJECG Probable carboxypeptidase HCBG_00059 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_00059 PE=3 SV=1 34 390 2.0E-84
sp|C1GQH3|P20D1_PARBA Probable carboxypeptidase PAAG_00768 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_00768 PE=3 SV=1 4 390 1.0E-83
sp|B8NPN0|P20D1_ASPFN Probable carboxypeptidase AFLA_000940 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_000940 PE=3 SV=1 15 394 7.0E-83
sp|C5JH24|P20D1_AJEDS Probable carboxypeptidase BDBG_01803 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_01803 PE=3 SV=1 34 390 2.0E-82
sp|C5GFX4|P20D1_AJEDR Probable carboxypeptidase BDCG_03757 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_03757 PE=3 SV=1 34 390 2.0E-82
sp|Q2U9N9|P20D1_ASPOR Probable carboxypeptidase AO090166000075 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090166000075 PE=3 SV=1 9 394 7.0E-82
sp|A1CE70|P20D1_ASPCL Probable carboxypeptidase ACLA_088580 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_088580 PE=3 SV=1 34 394 2.0E-78
sp|O74916|YJ75_SCHPO Peptidase M20 domain-containing protein C757.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.05c PE=3 SV=1 23 394 6.0E-76
sp|Q5HKI1|DAPE_STAEQ Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dapE PE=3 SV=1 43 390 3.0E-19
sp|Q8CQC2|DAPE_STAES Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dapE PE=3 SV=1 43 390 4.0E-19
sp|A9IR81|DAPE_BORPD Succinyl-diaminopimelate desuccinylase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dapE PE=3 SV=1 34 309 2.0E-18
sp|C5BC62|ARGE_EDWI9 Acetylornithine deacetylase OS=Edwardsiella ictaluri (strain 93-146) GN=argE PE=3 SV=1 36 392 1.0E-17
sp|Q66G73|ARGE_YERPS Acetylornithine deacetylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argE PE=3 SV=1 36 392 1.0E-17
sp|Q8ZA85|ARGE_YERPE Acetylornithine deacetylase OS=Yersinia pestis GN=argE PE=3 SV=1 36 392 1.0E-17
sp|A7FCZ8|ARGE_YERP3 Acetylornithine deacetylase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argE PE=3 SV=1 36 392 1.0E-17
sp|C6DI82|ARGE_PECCP Acetylornithine deacetylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=argE PE=3 SV=1 36 392 4.0E-17
sp|Q6GF48|DAPE_STAAR Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MRSA252) GN=dapE PE=3 SV=1 33 372 5.0E-17
sp|Q6DAR2|ARGE_PECAS Acetylornithine deacetylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argE PE=3 SV=1 36 392 6.0E-17
sp|Q2L2J6|DAPE_BORA1 Succinyl-diaminopimelate desuccinylase OS=Bordetella avium (strain 197N) GN=dapE PE=3 SV=1 34 310 2.0E-16
sp|Q32AB8|ARGE_SHIDS Acetylornithine deacetylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=argE PE=3 SV=1 36 392 9.0E-16
sp|C1D8X7|DAPE_LARHH Succinyl-diaminopimelate desuccinylase OS=Laribacter hongkongensis (strain HLHK9) GN=dapE PE=3 SV=1 37 310 1.0E-15
sp|B7NU43|ARGE_ECO7I Acetylornithine deacetylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|B1LNR7|ARGE_ECOSM Acetylornithine deacetylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|B5Z059|ARGE_ECO5E Acetylornithine deacetylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|Q8X742|ARGE_ECO57 Acetylornithine deacetylase OS=Escherichia coli O157:H7 GN=argE PE=3 SV=1 36 392 1.0E-15
sp|A9MI13|ARGE_SALAR Acetylornithine deacetylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|B7UNT3|ARGE_ECO27 Acetylornithine deacetylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=argE PE=3 SV=1 36 392 1.0E-15
sp|B6I5H3|ARGE_ECOSE Acetylornithine deacetylase OS=Escherichia coli (strain SE11) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7M711|ARGE_ECO8A Acetylornithine deacetylase OS=Escherichia coli O8 (strain IAI1) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|Q8FB97|ARGE_ECOL6 Acetylornithine deacetylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argE PE=3 SV=2 36 392 2.0E-15
sp|Q0TAA3|ARGE_ECOL5 Acetylornithine deacetylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7MR48|ARGE_ECO81 Acetylornithine deacetylase OS=Escherichia coli O81 (strain ED1a) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7MI93|ARGE_ECO45 Acetylornithine deacetylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|P23908|ARGE_ECOLI Acetylornithine deacetylase OS=Escherichia coli (strain K12) GN=argE PE=1 SV=2 36 392 2.0E-15
sp|B1IVC1|ARGE_ECOLC Acetylornithine deacetylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B1XBC2|ARGE_ECODH Acetylornithine deacetylase OS=Escherichia coli (strain K12 / DH10B) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|C5A0C3|ARGE_ECOBW Acetylornithine deacetylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7LA57|ARGE_ECO55 Acetylornithine deacetylase OS=Escherichia coli (strain 55989 / EAEC) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|Q31U31|ARGE_SHIBS Acetylornithine deacetylase OS=Shigella boydii serotype 4 (strain Sb227) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|Q8ZKL9|ARGE_SALTY Acetylornithine deacetylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|B7NFQ7|ARGE_ECOLU Acetylornithine deacetylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argE PE=3 SV=1 36 392 2.0E-15
sp|Q0SY37|ARGE_SHIF8 Acetylornithine deacetylase OS=Shigella flexneri serotype 5b (strain 8401) GN=argE PE=3 SV=1 36 392 3.0E-15
sp|P59600|ARGE_SHIFL Acetylornithine deacetylase OS=Shigella flexneri GN=argE PE=3 SV=1 36 392 3.0E-15
sp|A8A765|ARGE_ECOHS Acetylornithine deacetylase OS=Escherichia coli O9:H4 (strain HS) GN=argE PE=3 SV=1 36 392 3.0E-15
sp|B2TWF2|ARGE_SHIB3 Acetylornithine deacetylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=argE PE=3 SV=1 36 392 3.0E-15
sp|A7ZUH5|ARGE_ECO24 Acetylornithine deacetylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argE PE=3 SV=1 36 392 3.0E-15
sp|Q31G37|DAPE_THICR Succinyl-diaminopimelate desuccinylase OS=Thiomicrospira crunogena (strain XCL-2) GN=dapE PE=3 SV=1 34 309 4.0E-15
sp|B5F0U6|ARGE_SALA4 Acetylornithine deacetylase OS=Salmonella agona (strain SL483) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B4TQH3|ARGE_SALSV Acetylornithine deacetylase OS=Salmonella schwarzengrund (strain CVM19633) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|A9N0G7|ARGE_SALPB Acetylornithine deacetylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B4T0W8|ARGE_SALNS Acetylornithine deacetylase OS=Salmonella newport (strain SL254) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B5RF48|ARGE_SALG2 Acetylornithine deacetylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B5QXQ2|ARGE_SALEP Acetylornithine deacetylase OS=Salmonella enteritidis PT4 (strain P125109) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B5FPX2|ARGE_SALDC Acetylornithine deacetylase OS=Salmonella dublin (strain CT_02021853) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|Q57H96|ARGE_SALCH Acetylornithine deacetylase OS=Salmonella choleraesuis (strain SC-B67) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|B5BJN1|ARGE_SALPK Acetylornithine deacetylase OS=Salmonella paratyphi A (strain AKU_12601) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|Q5PK76|ARGE_SALPA Acetylornithine deacetylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=argE PE=3 SV=1 36 392 4.0E-15
sp|A9BZY6|DAPE_DELAS Succinyl-diaminopimelate desuccinylase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dapE PE=3 SV=1 34 323 5.0E-15
sp|A4WG54|ARGE_ENT38 Acetylornithine deacetylase OS=Enterobacter sp. (strain 638) GN=argE PE=3 SV=1 36 392 6.0E-15
sp|B2VGA3|ARGE_ERWT9 Acetylornithine deacetylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argE PE=3 SV=1 36 392 8.0E-15
sp|B7LUN8|ARGE_ESCF3 Acetylornithine deacetylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=argE PE=3 SV=1 36 392 1.0E-14
sp|B4TCQ3|ARGE_SALHS Acetylornithine deacetylase OS=Salmonella heidelberg (strain SL476) GN=argE PE=3 SV=1 36 392 1.0E-14
sp|Q9PH30|DAPE_XYLFA Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain 9a5c) GN=dapE PE=3 SV=1 34 280 1.0E-14
sp|Q931I4|DAPE_STAAM Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapE PE=3 SV=1 33 372 2.0E-14
sp|Q0A7H5|DAPE_ALKEH Succinyl-diaminopimelate desuccinylase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dapE PE=3 SV=1 34 310 2.0E-14
sp|P57155|ARGE_BUCAI Acetylornithine deacetylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argE PE=3 SV=1 36 374 2.0E-14
sp|Q8NVL7|DAPE_STAAW Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MW2) GN=dapE PE=3 SV=1 33 372 2.0E-14
sp|Q6G7T6|DAPE_STAAS Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MSSA476) GN=dapE PE=3 SV=1 33 372 2.0E-14
sp|Q99SN6|DAPE_STAAN Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain N315) GN=dapE PE=1 SV=1 33 372 2.0E-14
sp|Q8Z308|ARGE_SALTI Acetylornithine deacetylase OS=Salmonella typhi GN=argE PE=3 SV=1 36 392 3.0E-14
sp|B0RW53|DAPE_XANCB Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=dapE PE=3 SV=1 34 310 4.0E-14
sp|Q7W8Y3|DAPE_BORPA Succinyl-diaminopimelate desuccinylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dapE PE=3 SV=1 34 310 4.0E-14
sp|A1W7M0|DAPE_ACISJ Succinyl-diaminopimelate desuccinylase OS=Acidovorax sp. (strain JS42) GN=dapE PE=3 SV=1 34 310 4.0E-14
sp|A1UUD2|DAPE_BARBK Succinyl-diaminopimelate desuccinylase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dapE PE=3 SV=1 37 287 4.0E-14
sp|Q8PAU0|DAPE_XANCP Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dapE PE=3 SV=2 34 310 4.0E-14
sp|Q4USS4|DAPE_XANC8 Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dapE PE=3 SV=2 34 310 4.0E-14
sp|B8D6V9|ARGE_BUCAT Acetylornithine deacetylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=argE PE=3 SV=1 36 374 5.0E-14
sp|Q3YV19|ARGE_SHISS Acetylornithine deacetylase OS=Shigella sonnei (strain Ss046) GN=argE PE=3 SV=1 36 392 5.0E-14
sp|O34984|YODQ_BACSU Uncharacterized metallohydrolase YodQ OS=Bacillus subtilis (strain 168) GN=yodQ PE=3 SV=1 101 394 7.0E-14
sp|C5CLT2|DAPE_VARPS Succinyl-diaminopimelate desuccinylase OS=Variovorax paradoxus (strain S110) GN=dapE PE=3 SV=1 34 309 7.0E-14
sp|B5ES53|DAPE_ACIF5 Succinyl-diaminopimelate desuccinylase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dapE PE=3 SV=1 33 309 7.0E-14
sp|B7JBS5|DAPE_ACIF2 Succinyl-diaminopimelate desuccinylase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dapE PE=3 SV=1 33 309 7.0E-14
sp|B5XZ19|ARGE_KLEP3 Acetylornithine deacetylase OS=Klebsiella pneumoniae (strain 342) GN=argE PE=3 SV=1 36 392 7.0E-14
sp|B9MJL1|DAPE_ACIET Succinyl-diaminopimelate desuccinylase OS=Acidovorax ebreus (strain TPSY) GN=dapE PE=3 SV=1 34 310 9.0E-14
sp|Q5QTZ3|DAPE_IDILO Succinyl-diaminopimelate desuccinylase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dapE PE=3 SV=1 34 310 1.0E-13
sp|B0U296|DAPE_XYLFM Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain M12) GN=dapE PE=3 SV=1 34 280 2.0E-13
sp|Q7MYD5|ARGE_PHOLL Acetylornithine deacetylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argE PE=3 SV=1 36 392 2.0E-13
sp|A1WEL1|DAPE_VEREI Succinyl-diaminopimelate desuccinylase OS=Verminephrobacter eiseniae (strain EF01-2) GN=dapE PE=3 SV=1 37 310 2.0E-13
sp|Q1R039|DAPE_CHRSD Succinyl-diaminopimelate desuccinylase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dapE PE=3 SV=1 22 234 2.0E-13
sp|B4F192|ARGE_PROMH Acetylornithine deacetylase OS=Proteus mirabilis (strain HI4320) GN=argE PE=3 SV=1 36 390 2.0E-13
sp|A1U3R0|DAPE_MARHV Succinyl-diaminopimelate desuccinylase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dapE PE=3 SV=1 34 310 3.0E-13
sp|Q7MH69|ARGE_VIBVY Acetylornithine deacetylase OS=Vibrio vulnificus (strain YJ016) GN=argE PE=3 SV=1 50 384 3.0E-13
sp|Q82XY4|DAPE_NITEU Succinyl-diaminopimelate desuccinylase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dapE PE=3 SV=1 37 310 4.0E-13
sp|B4RKY8|DAPE_NEIG2 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=dapE PE=3 SV=2 33 310 5.0E-13
sp|B6EJS8|DAPE_ALISL Succinyl-diaminopimelate desuccinylase OS=Aliivibrio salmonicida (strain LFI1238) GN=dapE PE=3 SV=1 37 310 5.0E-13
sp|Q8DBA6|DAPE_VIBVU Succinyl-diaminopimelate desuccinylase OS=Vibrio vulnificus (strain CMCP6) GN=dapE PE=3 SV=1 34 312 5.0E-13
sp|Q7WKC6|DAPE_BORBR Succinyl-diaminopimelate desuccinylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dapE PE=3 SV=1 34 310 5.0E-13
sp|A4G4Q7|DAPE_HERAR Succinyl-diaminopimelate desuccinylase OS=Herminiimonas arsenicoxydans GN=dapE PE=3 SV=1 34 324 6.0E-13
sp|Q3SJE0|DAPE_THIDA Succinyl-diaminopimelate desuccinylase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dapE PE=3 SV=1 34 296 7.0E-13
sp|Q5F812|DAPE_NEIG1 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dapE PE=3 SV=1 33 310 7.0E-13
sp|B8D8K5|ARGE_BUCA5 Acetylornithine deacetylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=argE PE=3 SV=1 36 374 8.0E-13
sp|Q21WT4|DAPE_RHOFT Succinyl-diaminopimelate desuccinylase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dapE PE=3 SV=1 37 310 8.0E-13
sp|A9ILD7|DAPE_BART1 Succinyl-diaminopimelate desuccinylase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dapE PE=3 SV=1 37 287 8.0E-13
sp|Q12C18|DAPE_POLSJ Succinyl-diaminopimelate desuccinylase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dapE PE=3 SV=1 34 310 8.0E-13
sp|Q0BUB7|DAPE_GRABC Succinyl-diaminopimelate desuccinylase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dapE PE=3 SV=2 34 304 9.0E-13
sp|Q9JYL2|DAPE_NEIMB Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=dapE PE=1 SV=1 33 310 1.0E-12
sp|Q87F49|DAPE_XYLFT Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dapE PE=3 SV=1 34 280 1.0E-12
sp|B2I6B4|DAPE_XYLF2 Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain M23) GN=dapE PE=3 SV=1 34 280 1.0E-12
sp|A1KUW7|DAPE_NEIMF Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dapE PE=3 SV=1 33 310 1.0E-12
sp|Q3BVJ3|DAPE_XANC5 Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dapE PE=3 SV=1 34 310 1.0E-12
sp|Q9CLT9|ARGE_PASMU Acetylornithine deacetylase OS=Pasteurella multocida (strain Pm70) GN=argE PE=3 SV=2 58 390 1.0E-12
sp|Q9YBY3|LYSK_AERPE N-acetyl-lysine deacetylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=lysK PE=3 SV=2 50 390 1.0E-12
sp|A9HKR2|DAPE_GLUDA Succinyl-diaminopimelate desuccinylase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dapE PE=3 SV=1 24 287 1.0E-12
sp|Q2Y7X4|DAPE_NITMU Succinyl-diaminopimelate desuccinylase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dapE PE=3 SV=1 34 310 1.0E-12
sp|B2SQY5|DAPE_XANOP Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dapE PE=3 SV=1 34 310 2.0E-12
sp|Q7VXJ5|DAPE_BORPE Succinyl-diaminopimelate desuccinylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dapE PE=3 SV=1 34 310 2.0E-12
sp|Q8DCN1|ARGE_VIBVU Acetylornithine deacetylase OS=Vibrio vulnificus (strain CMCP6) GN=argE PE=3 SV=1 50 384 2.0E-12
sp|A2SGS4|DAPE_METPP Succinyl-diaminopimelate desuccinylase OS=Methylibium petroleiphilum (strain PM1) GN=dapE PE=3 SV=1 37 309 2.0E-12
sp|A9M0W6|DAPE_NEIM0 Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C (strain 053442) GN=dapE PE=3 SV=1 33 310 2.0E-12
sp|C5BQE9|DAPE_TERTT Succinyl-diaminopimelate desuccinylase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dapE PE=3 SV=1 34 304 2.0E-12
sp|Q5H1C8|DAPE_XANOR Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dapE PE=3 SV=2 34 310 2.0E-12
sp|Q2P492|DAPE_XANOM Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dapE PE=3 SV=1 34 310 2.0E-12
sp|A1ISU7|DAPE_NEIMA Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dapE PE=3 SV=1 33 310 2.0E-12
sp|Q3J9B0|DAPE_NITOC Succinyl-diaminopimelate desuccinylase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dapE PE=3 SV=1 34 287 2.0E-12
sp|B5FBP7|ARGE_VIBFM Acetylornithine deacetylase OS=Vibrio fischeri (strain MJ11) GN=argE PE=3 SV=1 106 383 3.0E-12
sp|Q7MIL6|DAPE_VIBVY Succinyl-diaminopimelate desuccinylase OS=Vibrio vulnificus (strain YJ016) GN=dapE PE=3 SV=2 34 312 3.0E-12
sp|B3CRZ3|DAPE_ORITI Succinyl-diaminopimelate desuccinylase OS=Orientia tsutsugamushi (strain Ikeda) GN=dapE PE=3 SV=1 33 312 3.0E-12
sp|A3QGR1|DAPE2_SHELP Succinyl-diaminopimelate desuccinylase 2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dapE2 PE=3 SV=1 41 326 3.0E-12
sp|Q1LNH3|DAPE_CUPMC Succinyl-diaminopimelate desuccinylase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dapE PE=3 SV=1 37 309 3.0E-12
sp|A6SZR5|DAPE_JANMA Succinyl-diaminopimelate desuccinylase OS=Janthinobacterium sp. (strain Marseille) GN=dapE PE=3 SV=1 34 310 4.0E-12
sp|Q5E2E4|ARGE_VIBF1 Acetylornithine deacetylase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argE PE=3 SV=1 106 383 4.0E-12
sp|Q8PMJ5|DAPE_XANAC Succinyl-diaminopimelate desuccinylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dapE PE=3 SV=1 34 310 4.0E-12
sp|P9WHS9|DAPE_MYCTU Putative succinyl-diaminopimelate desuccinylase DapE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dapE PE=1 SV=1 33 384 4.0E-12
sp|P9WHS8|DAPE_MYCTO Putative succinyl-diaminopimelate desuccinylase DapE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dapE PE=3 SV=1 33 384 4.0E-12
sp|A1S647|DAPE_SHEAM Succinyl-diaminopimelate desuccinylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dapE PE=3 SV=1 28 287 4.0E-12
sp|B4SQ35|DAPE_STRM5 Succinyl-diaminopimelate desuccinylase OS=Stenotrophomonas maltophilia (strain R551-3) GN=dapE PE=3 SV=1 34 310 5.0E-12
sp|C3LPF7|DAPE_VIBCM Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dapE PE=3 SV=1 34 309 5.0E-12
sp|Q9KQ52|DAPE_VIBCH Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dapE PE=1 SV=1 34 309 5.0E-12
sp|A5F6B5|DAPE_VIBC3 Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dapE PE=3 SV=1 34 309 5.0E-12
sp|P59085|ARGE_BUCAP Acetylornithine deacetylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argE PE=3 SV=1 36 390 6.0E-12
sp|Q5FPX5|DAPE_GLUOX Succinyl-diaminopimelate desuccinylase OS=Gluconobacter oxydans (strain 621H) GN=dapE PE=3 SV=2 32 287 7.0E-12
sp|A0R2G4|DAPE_MYCS2 Succinyl-diaminopimelate desuccinylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dapE PE=3 SV=1 37 390 1.0E-11
sp|A1TQ19|DAPE_ACIAC Succinyl-diaminopimelate desuccinylase OS=Acidovorax citrulli (strain AAC00-1) GN=dapE PE=3 SV=1 34 310 1.0E-11
sp|B2FIC0|DAPE_STRMK Succinyl-diaminopimelate desuccinylase OS=Stenotrophomonas maltophilia (strain K279a) GN=dapE PE=3 SV=1 34 308 1.0E-11
sp|Q0ADY0|DAPE_NITEC Succinyl-diaminopimelate desuccinylase OS=Nitrosomonas eutropha (strain C91) GN=dapE PE=3 SV=1 37 310 2.0E-11
sp|Q7NY19|DAPE_CHRVO Succinyl-diaminopimelate desuccinylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dapE PE=3 SV=1 34 310 2.0E-11
sp|Q5E3I7|DAPE_VIBF1 Succinyl-diaminopimelate desuccinylase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dapE PE=3 SV=1 27 314 2.0E-11
sp|P59601|ARGE_VIBPA Acetylornithine deacetylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argE PE=3 SV=1 50 384 2.0E-11
sp|Q15TS8|DAPE_PSEA6 Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dapE PE=3 SV=1 35 312 2.0E-11
sp|B7VLL4|ARGE_VIBTL Acetylornithine deacetylase OS=Vibrio tasmaniensis (strain LGP32) GN=argE PE=3 SV=1 36 384 2.0E-11
sp|Q0VQG3|DAPE_ALCBS Succinyl-diaminopimelate desuccinylase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapE PE=3 SV=1 85 395 2.0E-11
sp|Q5P9A2|DAPE_ANAMM Succinyl-diaminopimelate desuccinylase OS=Anaplasma marginale (strain St. Maries) GN=dapE PE=3 SV=2 37 390 3.0E-11
sp|B9KHC9|DAPE_ANAMF Succinyl-diaminopimelate desuccinylase OS=Anaplasma marginale (strain Florida) GN=dapE PE=3 SV=2 37 390 3.0E-11
sp|B1ZGA7|DAPE_METPB Succinyl-diaminopimelate desuccinylase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dapE PE=3 SV=1 37 302 4.0E-11
sp|A8FW04|DAPE_SHESH Succinyl-diaminopimelate desuccinylase OS=Shewanella sediminis (strain HAW-EB3) GN=dapE PE=3 SV=1 34 309 5.0E-11
sp|A1SXF9|DAPE_PSYIN Succinyl-diaminopimelate desuccinylase OS=Psychromonas ingrahamii (strain 37) GN=dapE PE=3 SV=1 34 287 5.0E-11
sp|A7MXC2|ARGE_VIBCB Acetylornithine deacetylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=argE PE=3 SV=1 50 384 5.0E-11
sp|Q3YT10|DAPE_EHRCJ Succinyl-diaminopimelate desuccinylase OS=Ehrlichia canis (strain Jake) GN=dapE PE=3 SV=2 37 287 6.0E-11
sp|Q2GAU5|DAPE_NOVAD Succinyl-diaminopimelate desuccinylase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dapE PE=3 SV=1 39 302 7.0E-11
sp|B0BTF3|DAPE_ACTPJ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dapE PE=3 SV=1 33 287 9.0E-11
sp|Q9CM22|DAPE_PASMU Succinyl-diaminopimelate desuccinylase OS=Pasteurella multocida (strain Pm70) GN=dapE PE=3 SV=1 33 298 9.0E-11
sp|Q6VE94|DAPE_PSESY Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. syringae GN=dapE PE=3 SV=1 34 310 1.0E-10
sp|Q59284|DAPE_CORGL Succinyl-diaminopimelate desuccinylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dapE PE=1 SV=1 39 289 1.0E-10
sp|Q8XZK5|DAPE_RALSO Succinyl-diaminopimelate desuccinylase OS=Ralstonia solanacearum (strain GMI1000) GN=dapE PE=3 SV=2 34 309 1.0E-10
sp|Q2W0E7|DAPE_MAGSA Succinyl-diaminopimelate desuccinylase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dapE PE=3 SV=1 37 287 1.0E-10
sp|B6EMN5|ARGE_ALISL Acetylornithine deacetylase OS=Aliivibrio salmonicida (strain LFI1238) GN=argE PE=3 SV=1 106 383 1.0E-10
sp|Q492F7|DAPE_BLOPB Succinyl-diaminopimelate desuccinylase OS=Blochmannia pennsylvanicus (strain BPEN) GN=dapE PE=3 SV=1 34 310 1.0E-10
sp|B8F824|DAPE_HAEPS Succinyl-diaminopimelate desuccinylase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dapE PE=3 SV=1 33 287 1.0E-10
sp|Q2NS82|DAPE_SODGM Succinyl-diaminopimelate desuccinylase OS=Sodalis glossinidius (strain morsitans) GN=dapE PE=3 SV=1 36 289 1.0E-10
sp|A5CCZ1|DAPE_ORITB Succinyl-diaminopimelate desuccinylase OS=Orientia tsutsugamushi (strain Boryong) GN=dapE PE=3 SV=1 33 312 2.0E-10
sp|Q9I4H5|DAPE_PSEAE Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dapE PE=3 SV=1 26 310 2.0E-10
sp|B7UX27|DAPE_PSEA8 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain LESB58) GN=dapE PE=3 SV=1 26 310 2.0E-10
sp|Q9V1I3|LYSK_PYRAB N-acetyl-lysine deacetylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=lysK PE=3 SV=1 33 225 2.0E-10
sp|B7VIL8|DAPE_VIBTL Succinyl-diaminopimelate desuccinylase OS=Vibrio tasmaniensis (strain LGP32) GN=dapE PE=3 SV=1 34 314 2.0E-10
sp|Q68VN9|DAPE_RICTY Succinyl-diaminopimelate desuccinylase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dapE PE=3 SV=1 41 288 2.0E-10
sp|Q1MM75|DAPE_RHIL3 Succinyl-diaminopimelate desuccinylase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dapE PE=3 SV=1 41 287 2.0E-10
sp|Q1GRJ2|DAPE_SPHAL Succinyl-diaminopimelate desuccinylase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=dapE PE=3 SV=1 37 323 3.0E-10
sp|Q2N7X8|DAPE_ERYLH Succinyl-diaminopimelate desuccinylase OS=Erythrobacter litoralis (strain HTCC2594) GN=dapE PE=3 SV=1 34 305 3.0E-10
sp|A5FYQ7|DAPE_ACICJ Succinyl-diaminopimelate desuccinylase OS=Acidiphilium cryptum (strain JF-5) GN=dapE PE=3 SV=1 34 287 3.0E-10
sp|A4SPS7|DAPE_AERS4 Succinyl-diaminopimelate desuccinylase OS=Aeromonas salmonicida (strain A449) GN=dapE PE=3 SV=1 34 310 3.0E-10
sp|Q7N3J4|DAPE_PHOLL Succinyl-diaminopimelate desuccinylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dapE PE=3 SV=1 36 308 3.0E-10
sp|Q6G1H9|DAPE_BARQU Succinyl-diaminopimelate desuccinylase OS=Bartonella quintana (strain Toulouse) GN=dapE PE=3 SV=1 37 287 4.0E-10
sp|Q02IY2|DAPE_PSEAB Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dapE PE=3 SV=1 26 310 4.0E-10
sp|A6V936|DAPE_PSEA7 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain PA7) GN=dapE PE=3 SV=1 26 310 4.0E-10
sp|A5UFQ7|DAPE_HAEIG Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain PittGG) GN=dapE PE=3 SV=1 33 287 4.0E-10
sp|B4EY70|DAPE_PROMH Succinyl-diaminopimelate desuccinylase OS=Proteus mirabilis (strain HI4320) GN=dapE PE=3 SV=1 36 289 4.0E-10
sp|Q7VF72|DAPE_HELHP Succinyl-diaminopimelate desuccinylase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dapE PE=3 SV=1 37 308 4.0E-10
sp|B6IPH8|DAPE_RHOCS Succinyl-diaminopimelate desuccinylase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dapE PE=3 SV=1 37 287 5.0E-10
sp|Q4QP83|DAPE_HAEI8 Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain 86-028NP) GN=dapE PE=3 SV=1 33 234 5.0E-10
sp|A9W376|DAPE_METEP Succinyl-diaminopimelate desuccinylase OS=Methylobacterium extorquens (strain PA1) GN=dapE PE=3 SV=2 37 302 6.0E-10
sp|B0T134|DAPE_CAUSK Succinyl-diaminopimelate desuccinylase OS=Caulobacter sp. (strain K31) GN=dapE PE=3 SV=2 37 287 7.0E-10
sp|B2T5K8|DAPE_BURPP Succinyl-diaminopimelate desuccinylase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dapE PE=3 SV=1 37 390 7.0E-10
sp|A7ML10|DAPE_CROS8 Succinyl-diaminopimelate desuccinylase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dapE PE=3 SV=1 36 310 8.0E-10
sp|O68873|ARGE_MYXXA Acetylornithine deacetylase OS=Myxococcus xanthus GN=argE PE=1 SV=1 26 379 9.0E-10
sp|Q87MI6|DAPE_VIBPA Succinyl-diaminopimelate desuccinylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dapE PE=3 SV=1 34 312 9.0E-10
sp|Q13XA2|DAPE_BURXL Succinyl-diaminopimelate desuccinylase OS=Burkholderia xenovorans (strain LB400) GN=dapE PE=3 SV=2 37 310 9.0E-10
sp|Q0TF05|DAPE_ECOL5 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dapE PE=3 SV=1 36 310 9.0E-10
sp|A1VN92|DAPE_POLNA Succinyl-diaminopimelate desuccinylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=dapE PE=3 SV=1 34 295 1.0E-09
sp|Q1R8Q6|DAPE_ECOUT Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain UTI89 / UPEC) GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|Q8FF82|DAPE_ECOL6 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|A1ADX7|DAPE_ECOK1 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O1:K1 / APEC GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|B7MHW4|DAPE_ECO45 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|A4XWV4|DAPE_PSEMY Succinyl-diaminopimelate desuccinylase OS=Pseudomonas mendocina (strain ymp) GN=dapE PE=3 SV=1 37 234 1.0E-09
sp|A4VMY9|DAPE_PSEU5 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas stutzeri (strain A1501) GN=dapE PE=3 SV=1 34 234 1.0E-09
sp|Q7VNB3|DAPE_HAEDU Succinyl-diaminopimelate desuccinylase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dapE PE=3 SV=1 33 234 1.0E-09
sp|Q32D98|DAPE_SHIDS Succinyl-diaminopimelate desuccinylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dapE PE=3 SV=1 36 274 1.0E-09
sp|P44514|DAPE_HAEIN Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dapE PE=1 SV=1 33 287 1.0E-09
sp|Q3IL20|DAPE_PSEHT Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dapE PE=3 SV=1 34 310 1.0E-09
sp|B0TVI4|DAPE_SHEHH Succinyl-diaminopimelate desuccinylase OS=Shewanella halifaxensis (strain HAW-EB4) GN=dapE PE=3 SV=1 34 309 1.0E-09
sp|A4WD51|DAPE_ENT38 Succinyl-diaminopimelate desuccinylase OS=Enterobacter sp. (strain 638) GN=dapE PE=3 SV=1 36 289 1.0E-09
sp|B5Z008|DAPE_ECO5E Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|Q8XBE0|DAPE_ECO57 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O157:H7 GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|P0AED8|DAPE_SHIFL Succinyl-diaminopimelate desuccinylase OS=Shigella flexneri GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|Q31Y20|DAPE_SHIBS Succinyl-diaminopimelate desuccinylase OS=Shigella boydii serotype 4 (strain Sb227) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B1LNC1|DAPE_ECOSM Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|P0AED7|DAPE_ECOLI Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12) GN=dapE PE=1 SV=1 36 289 2.0E-09
sp|B1IWI8|DAPE_ECOLC Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|A8A2W3|DAPE_ECOHS Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O9:H4 (strain HS) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B1XAE3|DAPE_ECODH Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12 / DH10B) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|C4ZX46|DAPE_ECOBW Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B7M7H2|DAPE_ECO8A Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O8 (strain IAI1) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B7LCK7|DAPE_ECO55 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain 55989 / EAEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B7UGM1|DAPE_ECO27 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|A7ZPR5|DAPE_ECO24 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|B2TXP7|DAPE_SHIB3 Succinyl-diaminopimelate desuccinylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|O59402|LYSK_PYRHO N-acetyl-lysine deacetylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=lysK PE=3 SV=1 34 226 2.0E-09
sp|Q886Q4|DAPE_PSESM Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dapE PE=3 SV=1 28 310 2.0E-09
sp|Q3YZ81|DAPE_SHISS Succinyl-diaminopimelate desuccinylase OS=Shigella sonnei (strain Ss046) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|A5UB44|DAPE_HAEIE Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain PittEE) GN=dapE PE=3 SV=1 33 234 2.0E-09
sp|B6I539|DAPE_ECOSE Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain SE11) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|C3LRV6|ARGE_VIBCM Acetylornithine deacetylase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=argE PE=3 SV=1 50 383 2.0E-09
sp|Q9KNT5|ARGE_VIBCH Acetylornithine deacetylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argE PE=3 SV=1 50 383 2.0E-09
sp|A5F4Z7|ARGE_VIBC3 Acetylornithine deacetylase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=argE PE=3 SV=1 50 383 2.0E-09
sp|A1JL17|DAPE_YERE8 Succinyl-diaminopimelate desuccinylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dapE PE=3 SV=1 36 310 2.0E-09
sp|Q0ASJ5|DAPE_MARMM Succinyl-diaminopimelate desuccinylase OS=Maricaulis maris (strain MCS10) GN=dapE PE=3 SV=1 37 229 2.0E-09
sp|Q65US9|DAPE_MANSM Succinyl-diaminopimelate desuccinylase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dapE PE=3 SV=1 33 287 2.0E-09
sp|B7LKH0|DAPE_ESCF3 Succinyl-diaminopimelate desuccinylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|A8ADB6|DAPE_CITK8 Succinyl-diaminopimelate desuccinylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dapE PE=3 SV=1 36 310 2.0E-09
sp|A7FG57|DAPE_YERP3 Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dapE PE=3 SV=1 36 310 2.0E-09
sp|B7NQK9|DAPE_ECO7I Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dapE PE=3 SV=1 36 289 2.0E-09
sp|Q11LD2|DAPE_CHESB Succinyl-diaminopimelate desuccinylase OS=Chelativorans sp. (strain BNC1) GN=dapE PE=3 SV=1 42 287 2.0E-09
sp|B5ZN23|DAPE_RHILW Succinyl-diaminopimelate desuccinylase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dapE PE=3 SV=1 41 287 3.0E-09
sp|B7N653|DAPE_ECOLU Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dapE PE=3 SV=1 36 289 3.0E-09
sp|A0L3N2|DAPE_MAGMM Succinyl-diaminopimelate desuccinylase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dapE PE=3 SV=2 37 290 3.0E-09
sp|Q9K4Z7|ARGE_MORPR Acetylornithine deacetylase OS=Moritella profunda GN=argE PE=1 SV=1 38 390 3.0E-09
sp|Q4FNF5|DAPE_PELUB Succinyl-diaminopimelate desuccinylase OS=Pelagibacter ubique (strain HTCC1062) GN=dapE PE=3 SV=1 30 287 3.0E-09
sp|Q2RNM1|DAPE_RHORT Succinyl-diaminopimelate desuccinylase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=dapE PE=3 SV=2 37 287 4.0E-09
sp|A6VUR6|DAPE_MARMS Succinyl-diaminopimelate desuccinylase OS=Marinomonas sp. (strain MWYL1) GN=dapE PE=3 SV=2 34 310 4.0E-09
sp|B2VE50|DAPE_ERWT9 Succinyl-diaminopimelate desuccinylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dapE PE=3 SV=1 36 310 4.0E-09
sp|Q0T246|DAPE_SHIF8 Succinyl-diaminopimelate desuccinylase OS=Shigella flexneri serotype 5b (strain 8401) GN=dapE PE=3 SV=1 36 289 4.0E-09
sp|Q8KA25|DAPE_BUCAP Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dapE PE=3 SV=1 36 298 5.0E-09
sp|B1Y6E7|DAPE_LEPCP Succinyl-diaminopimelate desuccinylase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dapE PE=3 SV=1 37 323 5.0E-09
sp|Q083F0|DAPE_SHEFN Succinyl-diaminopimelate desuccinylase OS=Shewanella frigidimarina (strain NCIMB 400) GN=dapE PE=3 SV=1 34 309 5.0E-09
sp|A4YLC3|DAPE_BRASO Succinyl-diaminopimelate desuccinylase OS=Bradyrhizobium sp. (strain ORS278) GN=dapE PE=3 SV=1 34 287 5.0E-09
sp|A8H424|DAPE_SHEPA Succinyl-diaminopimelate desuccinylase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dapE PE=3 SV=1 33 309 6.0E-09
sp|B1JSH5|DAPE_YERPY Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q668G5|DAPE_YERPS Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|A4TMM3|DAPE_YERPP Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis (strain Pestoides F) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q1CK18|DAPE_YERPN Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|A9R2H7|DAPE_YERPG Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q7CJI9|DAPE_YERPE Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|B2K985|DAPE_YERPB Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q1C5R3|DAPE_YERPA Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dapE PE=3 SV=1 36 310 6.0E-09
sp|Q21HG2|DAPE_SACD2 Succinyl-diaminopimelate desuccinylase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dapE PE=3 SV=1 31 310 6.0E-09
sp|A7MY37|DAPE_VIBCB Succinyl-diaminopimelate desuccinylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dapE PE=3 SV=1 34 310 6.0E-09
sp|A4SYV9|DAPE_POLSQ Succinyl-diaminopimelate desuccinylase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=dapE PE=3 SV=1 34 308 7.0E-09
sp|Q6NC49|DAPE_RHOPA Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dapE PE=3 SV=1 27 287 7.0E-09
sp|Q2KD47|DAPE_RHIEC Succinyl-diaminopimelate desuccinylase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dapE PE=3 SV=2 41 287 7.0E-09
sp|Q9K4Z2|ARGE_MORAB Acetylornithine deacetylase OS=Moritella abyssi GN=argE PE=1 SV=1 38 390 7.0E-09
sp|A5WD56|DAPE_PSYWF Succinyl-diaminopimelate desuccinylase OS=Psychrobacter sp. (strain PRwf-1) GN=dapE PE=3 SV=1 26 310 7.0E-09
sp|B3QCH4|DAPE_RHOPT Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain TIE-1) GN=dapE PE=3 SV=1 27 287 8.0E-09
sp|Q48F49|DAPE_PSE14 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dapE PE=3 SV=1 28 310 9.0E-09
sp|B4RDU4|DAPE_PHEZH Succinyl-diaminopimelate desuccinylase OS=Phenylobacterium zucineum (strain HLK1) GN=dapE PE=3 SV=1 37 287 9.0E-09
sp|A6Q7J0|DAPE_SULNB Succinyl-diaminopimelate desuccinylase OS=Sulfurovum sp. (strain NBC37-1) GN=dapE PE=3 SV=1 36 271 1.0E-08
sp|B8CMP0|DAPE_SHEPW Succinyl-diaminopimelate desuccinylase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dapE PE=3 SV=1 34 309 1.0E-08
sp|A1AVU9|DAPE_RUTMC Succinyl-diaminopimelate desuccinylase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dapE PE=3 SV=1 34 290 1.0E-08
sp|Q4KHI7|DAPE_PSEF5 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dapE PE=3 SV=1 31 234 1.0E-08
sp|A3QE30|DAPE1_SHELP Succinyl-diaminopimelate desuccinylase 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dapE1 PE=3 SV=1 34 309 1.0E-08
sp|A1WX26|DAPE_HALHL Succinyl-diaminopimelate desuccinylase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dapE PE=3 SV=1 34 310 1.0E-08
sp|A1K719|DAPE_AZOSB Succinyl-diaminopimelate desuccinylase OS=Azoarcus sp. (strain BH72) GN=dapE PE=3 SV=1 37 234 1.0E-08
sp|B2JID9|DAPE_BURP8 Succinyl-diaminopimelate desuccinylase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dapE PE=3 SV=1 106 390 1.0E-08
sp|B8EA23|DAPE_SHEB2 Succinyl-diaminopimelate desuccinylase OS=Shewanella baltica (strain OS223) GN=dapE PE=3 SV=2 30 276 2.0E-08
sp|A6TC94|DAPE_KLEP7 Succinyl-diaminopimelate desuccinylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dapE PE=3 SV=1 36 289 2.0E-08
sp|Q0KA02|DAPE_CUPNH Succinyl-diaminopimelate desuccinylase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dapE PE=3 SV=1 37 310 2.0E-08
sp|A9NCE9|DAPE_COXBR Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|B5XVN4|DAPE_KLEP3 Succinyl-diaminopimelate desuccinylase OS=Klebsiella pneumoniae (strain 342) GN=dapE PE=3 SV=1 36 289 2.0E-08
sp|B1KDS3|DAPE_SHEWM Succinyl-diaminopimelate desuccinylase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dapE PE=3 SV=1 34 309 2.0E-08
sp|Q83DN2|DAPE_COXBU Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|A9KC82|DAPE_COXBN Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|B6J120|DAPE_COXB2 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuG_Q212) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|B6J929|DAPE_COXB1 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuK_Q154) GN=dapE PE=3 SV=1 34 289 2.0E-08
sp|Q2SBP0|DAPE_HAHCH Succinyl-diaminopimelate desuccinylase OS=Hahella chejuensis (strain KCTC 2396) GN=dapE PE=3 SV=1 34 310 2.0E-08
sp|A5ESQ3|DAPE_BRASB Succinyl-diaminopimelate desuccinylase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=dapE PE=3 SV=1 34 287 2.0E-08
sp|B3R2D1|DAPE_CUPTR Succinyl-diaminopimelate desuccinylase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dapE PE=3 SV=1 37 310 2.0E-08
sp|Q12N78|DAPE_SHEDO Succinyl-diaminopimelate desuccinylase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dapE PE=3 SV=1 34 287 2.0E-08
sp|Q6D7N4|DAPE_PECAS Succinyl-diaminopimelate desuccinylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dapE PE=3 SV=1 36 310 2.0E-08
sp|A8GHK9|DAPE_SERP5 Succinyl-diaminopimelate desuccinylase OS=Serratia proteamaculans (strain 568) GN=dapE PE=3 SV=1 36 310 2.0E-08
sp|Q058B2|DAPE_BUCCC Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapE PE=3 SV=1 34 231 3.0E-08
sp|Q470C3|DAPE_CUPPJ Succinyl-diaminopimelate desuccinylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dapE PE=3 SV=1 37 310 3.0E-08
sp|Q8ZN75|DAPE_SALTY Succinyl-diaminopimelate desuccinylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dapE PE=1 SV=1 36 310 3.0E-08
sp|B4TR55|DAPE_SALSV Succinyl-diaminopimelate desuccinylase OS=Salmonella schwarzengrund (strain CVM19633) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|A9N2Z9|DAPE_SALPB Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B4T0L0|DAPE_SALNS Succinyl-diaminopimelate desuccinylase OS=Salmonella newport (strain SL254) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B4TD58|DAPE_SALHS Succinyl-diaminopimelate desuccinylase OS=Salmonella heidelberg (strain SL476) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B5RCV3|DAPE_SALG2 Succinyl-diaminopimelate desuccinylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B5R4J0|DAPE_SALEP Succinyl-diaminopimelate desuccinylase OS=Salmonella enteritidis PT4 (strain P125109) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B5FQH3|DAPE_SALDC Succinyl-diaminopimelate desuccinylase OS=Salmonella dublin (strain CT_02021853) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|A9MHQ8|DAPE_SALAR Succinyl-diaminopimelate desuccinylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|Q8U0B3|LYSK_PYRFU N-acetyl-lysine deacetylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=lysK PE=3 SV=1 34 218 3.0E-08
sp|A9CKC4|DAPE_AGRFC Succinyl-diaminopimelate desuccinylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dapE PE=3 SV=1 42 287 3.0E-08
sp|B5BB22|DAPE_SALPK Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi A (strain AKU_12601) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|C0PYS5|DAPE_SALPC Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi C (strain RKS4594) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|Q5PLR5|DAPE_SALPA Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|Q57LM8|DAPE_SALCH Succinyl-diaminopimelate desuccinylase OS=Salmonella choleraesuis (strain SC-B67) GN=dapE PE=3 SV=1 36 310 3.0E-08
sp|B0KS83|DAPE_PSEPG Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain GB-1) GN=dapE PE=3 SV=1 28 310 3.0E-08
sp|A0KIB5|DAPE_AERHH Succinyl-diaminopimelate desuccinylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dapE PE=3 SV=1 34 310 3.0E-08
sp|Q6LTW8|DAPE_PHOPR Succinyl-diaminopimelate desuccinylase OS=Photobacterium profundum GN=dapE PE=3 SV=1 34 309 4.0E-08
sp|B1JBS2|DAPE_PSEPW Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain W619) GN=dapE PE=3 SV=1 28 234 4.0E-08
sp|Q88MP5|DAPE_PSEPK Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain KT2440) GN=dapE PE=3 SV=1 28 310 4.0E-08
sp|A5W863|DAPE_PSEP1 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dapE PE=3 SV=1 28 310 4.0E-08
sp|A7ZFC1|DAPE_CAMC1 Succinyl-diaminopimelate desuccinylase OS=Campylobacter concisus (strain 13826) GN=dapE PE=3 SV=1 106 287 4.0E-08
sp|A3D547|DAPE_SHEB5 Succinyl-diaminopimelate desuccinylase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dapE PE=3 SV=2 30 276 4.0E-08
sp|B1XTT6|DAPE_POLNS Succinyl-diaminopimelate desuccinylase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=dapE PE=3 SV=1 34 295 4.0E-08
sp|B5F0L0|DAPE_SALA4 Succinyl-diaminopimelate desuccinylase OS=Salmonella agona (strain SL483) GN=dapE PE=3 SV=1 36 310 5.0E-08
sp|Q8Z4S2|DAPE_SALTI Succinyl-diaminopimelate desuccinylase OS=Salmonella typhi GN=dapE PE=3 SV=1 36 310 5.0E-08
sp|Q4FU86|DAPE_PSYA2 Succinyl-diaminopimelate desuccinylase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dapE PE=3 SV=1 35 304 5.0E-08
sp|A9L3M8|DAPE_SHEB9 Succinyl-diaminopimelate desuccinylase OS=Shewanella baltica (strain OS195) GN=dapE PE=3 SV=2 30 276 5.0E-08
sp|B9JZL9|DAPE_AGRVS Succinyl-diaminopimelate desuccinylase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dapE PE=3 SV=1 41 287 5.0E-08
sp|A6WNV3|DAPE_SHEB8 Succinyl-diaminopimelate desuccinylase OS=Shewanella baltica (strain OS185) GN=dapE PE=3 SV=1 30 276 5.0E-08
sp|Q9RUH3|LYSK_DEIRA N-acetyl-lysine deacetylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lysK PE=3 SV=1 39 226 6.0E-08
sp|Q13F22|DAPE_RHOPS Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisB5) GN=dapE PE=3 SV=1 35 298 6.0E-08
sp|Q6FE14|DAPE_ACIAD Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dapE PE=3 SV=1 33 310 7.0E-08
sp|Q4ZWU0|DAPE_PSEU2 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dapE PE=3 SV=1 28 310 9.0E-08
sp|Q5HC82|DAPE_EHRRW Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Welgevonden) GN=dapE PE=3 SV=1 37 287 1.0E-07
sp|A8F303|DAPE_RICM5 Succinyl-diaminopimelate desuccinylase OS=Rickettsia massiliae (strain Mtu5) GN=dapE PE=3 SV=2 41 257 1.0E-07
sp|A8GQ98|DAPE_RICAH Succinyl-diaminopimelate desuccinylase OS=Rickettsia akari (strain Hartford) GN=dapE PE=3 SV=2 41 314 1.0E-07
sp|A8IMH3|DAPE_AZOC5 Succinyl-diaminopimelate desuccinylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dapE PE=3 SV=2 37 287 1.0E-07
sp|C4K2X8|DAPE_RICPU Succinyl-diaminopimelate desuccinylase OS=Rickettsia peacockii (strain Rustic) GN=dapE PE=3 SV=1 41 257 1.0E-07
sp|Q92FY0|DAPE_RICCN Succinyl-diaminopimelate desuccinylase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dapE PE=3 SV=2 41 257 1.0E-07
sp|C3PM12|DAPE_RICAE Succinyl-diaminopimelate desuccinylase OS=Rickettsia africae (strain ESF-5) GN=dapE PE=3 SV=1 41 257 1.0E-07
sp|Q47Z95|DAPE_COLP3 Succinyl-diaminopimelate desuccinylase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dapE PE=3 SV=1 33 229 2.0E-07
sp|Q3SN25|DAPE_NITWN Succinyl-diaminopimelate desuccinylase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dapE PE=3 SV=1 34 287 2.0E-07
sp|Q5FFA0|DAPE_EHRRG Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Gardel) GN=dapE PE=3 SV=1 37 287 2.0E-07
sp|Q1I614|DAPE_PSEE4 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas entomophila (strain L48) GN=dapE PE=3 SV=1 28 310 2.0E-07
sp|Q1QH74|DAPE_NITHX Succinyl-diaminopimelate desuccinylase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dapE PE=3 SV=2 34 287 2.0E-07
sp|C4LDG0|DAPE_TOLAT Succinyl-diaminopimelate desuccinylase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dapE PE=3 SV=1 34 309 2.0E-07
sp|Q89BP2|DAPE_BRADU Succinyl-diaminopimelate desuccinylase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dapE PE=3 SV=1 34 287 2.0E-07
sp|B3H2U3|DAPE_ACTP7 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dapE PE=3 SV=1 33 287 2.0E-07
sp|A3N3G9|DAPE_ACTP2 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dapE PE=3 SV=1 33 287 2.0E-07
sp|A6U5J1|DAPE_SINMW Succinyl-diaminopimelate desuccinylase OS=Sinorhizobium medicae (strain WSM419) GN=dapE PE=3 SV=2 42 287 3.0E-07
sp|A6VMI0|DAPE_ACTSZ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dapE PE=3 SV=1 33 287 3.0E-07
sp|Q3KHC5|DAPE_PSEPF Succinyl-diaminopimelate desuccinylase OS=Pseudomonas fluorescens (strain Pf0-1) GN=dapE PE=3 SV=1 34 234 3.0E-07
sp|Q8EEB6|DAPE_SHEON Succinyl-diaminopimelate desuccinylase OS=Shewanella oneidensis (strain MR-1) GN=dapE PE=3 SV=1 38 276 3.0E-07
sp|Q0HUU6|DAPE_SHESR Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain MR-7) GN=dapE PE=3 SV=1 38 338 3.0E-07
sp|Q0HJ36|DAPE_SHESM Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain MR-4) GN=dapE PE=3 SV=1 38 338 3.0E-07
sp|Q5GS68|DAPE_WOLTR Succinyl-diaminopimelate desuccinylase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dapE PE=3 SV=1 37 296 4.0E-07
sp|Q47FB0|DAPE_DECAR Succinyl-diaminopimelate desuccinylase OS=Dechloromonas aromatica (strain RCB) GN=dapE PE=3 SV=1 37 298 4.0E-07
sp|P54542|YQJE_BACSU Uncharacterized protein YqjE OS=Bacillus subtilis (strain 168) GN=yqjE PE=3 SV=2 36 282 6.0E-07
sp|A4Y7B1|DAPE_SHEPC Succinyl-diaminopimelate desuccinylase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dapE PE=3 SV=1 38 276 8.0E-07
sp|B1M6P0|DAPE_METRJ Succinyl-diaminopimelate desuccinylase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dapE PE=3 SV=1 37 306 8.0E-07
sp|A1RJ78|DAPE_SHESW Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain W3-18-1) GN=dapE PE=3 SV=1 38 276 8.0E-07
sp|Q1QDC1|DAPE_PSYCK Succinyl-diaminopimelate desuccinylase OS=Psychrobacter cryohalolentis (strain K5) GN=dapE PE=3 SV=1 25 304 8.0E-07
sp|B9J8D0|DAPE_AGRRK Succinyl-diaminopimelate desuccinylase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dapE PE=3 SV=1 41 287 8.0E-07
sp|Q21B56|DAPE_RHOPB Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisB18) GN=dapE PE=3 SV=1 30 287 9.0E-07
sp|A0KWH4|DAPE_SHESA Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain ANA-3) GN=dapE PE=3 SV=1 38 338 9.0E-07
sp|B9KP62|DAPE_RHOSK Succinyl-diaminopimelate desuccinylase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=dapE PE=3 SV=1 37 301 1.0E-06
sp|Q3IYS2|DAPE_RHOS4 Succinyl-diaminopimelate desuccinylase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dapE PE=3 SV=1 37 301 1.0E-06
sp|A8F095|DAPE_RICCK Succinyl-diaminopimelate desuccinylase OS=Rickettsia canadensis (strain McKiel) GN=dapE PE=3 SV=1 41 261 1.0E-06
sp|A3PNH5|DAPE_RHOS1 Succinyl-diaminopimelate desuccinylase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dapE PE=3 SV=1 37 308 1.0E-06
sp|B3CLN1|DAPE_WOLPP Succinyl-diaminopimelate desuccinylase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dapE PE=3 SV=1 37 257 1.0E-06
sp|Q8ZUG2|LYSK_PYRAE N-acetyl-lysine deacetylase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=lysK PE=3 SV=1 38 387 2.0E-06
sp|B0VRY3|DAPE_ACIBS Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain SDF) GN=dapE PE=3 SV=1 85 310 2.0E-06
sp|B6JJP4|DAPE_OLICO Succinyl-diaminopimelate desuccinylase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dapE PE=3 SV=1 34 287 2.0E-06
sp|Q92SH1|DAPE_RHIME Succinyl-diaminopimelate desuccinylase OS=Rhizobium meliloti (strain 1021) GN=dapE PE=3 SV=1 85 287 2.0E-06
sp|Q98D57|DAPE_RHILO Succinyl-diaminopimelate desuccinylase OS=Rhizobium loti (strain MAFF303099) GN=dapE PE=3 SV=1 42 287 2.0E-06
sp|Q608D9|DAPE_METCA Succinyl-diaminopimelate desuccinylase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dapE PE=3 SV=1 34 310 3.0E-06
sp|Q07TX3|DAPE_RHOP5 Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisA53) GN=dapE PE=3 SV=1 37 287 3.0E-06
sp|B4ECP3|DAPE_BURCJ Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dapE PE=3 SV=1 34 310 4.0E-06
sp|Q5NYT7|DAPE_AROAE Succinyl-diaminopimelate desuccinylase OS=Aromatoleum aromaticum (strain EbN1) GN=dapE PE=3 SV=1 37 310 4.0E-06
sp|A7I005|DAPE_CAMHC Succinyl-diaminopimelate desuccinylase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dapE PE=3 SV=1 100 242 4.0E-06
sp|A9AHS8|DAPE_BURM1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dapE PE=3 SV=1 34 310 5.0E-06
sp|A7HPQ6|DAPE_PARL1 Succinyl-diaminopimelate desuccinylase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dapE PE=3 SV=1 23 314 6.0E-06
sp|B8ELJ6|DAPE_METSB Succinyl-diaminopimelate desuccinylase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dapE PE=3 SV=1 37 288 7.0E-06
sp|B0V4V8|DAPE_ACIBY Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AYE) GN=dapE PE=3 SV=1 85 310 8.0E-06
sp|B7I842|DAPE_ACIB5 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB0057) GN=dapE PE=3 SV=1 85 310 8.0E-06
sp|A3M8H2|DAPE_ACIBT Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dapE PE=3 SV=2 85 310 8.0E-06
sp|A4JF88|DAPE_BURVG Succinyl-diaminopimelate desuccinylase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dapE PE=3 SV=1 106 310 8.0E-06
sp|B7GXA3|DAPE_ACIB3 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB307-0294) GN=dapE PE=3 SV=1 85 310 8.0E-06
sp|B2HY23|DAPE_ACIBC Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ACICU) GN=dapE PE=3 SV=1 85 310 8.0E-06
sp|B8GPR9|DAPE_THISH Succinyl-diaminopimelate desuccinylase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dapE PE=3 SV=1 34 309 9.0E-06
sp|B3PBB9|DAPE_CELJU Succinyl-diaminopimelate desuccinylase OS=Cellvibrio japonicus (strain Ueda107) GN=dapE PE=3 SV=2 38 310 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1789
MRFPILTAIHALPLIASAAQRPLISSSSTPAYRSELLSLHRSLVSIESISGNEAAVGRFLESYLSGRGYTVTRQH
VGAAKDDRFNLLARPGDDNQSRRPRVVVTSHIDVVPPYIPYGISDDDEKINTDTIITGRGSVDAKGSVAAMVVAL
EQLRAAQTISDADAALVFVVGEEVNGDGMRTYARSLGSDGLPPAVIFGEPTENKLACGHKGILNCRVSARGTSGH
SGYPWLGKSANAVMVRAMAALLDADLGSSARFGNSTVNIGRFEGGVAANVIAENATVELAVRVAAGSEEDGAKLA
RRGIQSVLDRVDDEALTMNCVGGYGPVKCNCDVTGFDTVIVNYGTDIGNLKGNYTKYLYGPGSILVAHGARENLT
VGHLETAVEGYKNLILHALS
Coding >Ophio5|1789
ATGCGCTTCCCAATTCTCACCGCCATACACGCTCTGCCGCTAATCGCCAGCGCCGCGCAACGTCCCCTCATCAGC
TCATCATCGACGCCCGCCTACCGAAGCGAGCTGCTCAGCCTGCACCGCTCGCTCGTCTCCATCGAGTCCATCAGC
GGAAATGAGGCCGCCGTCGGACGCTTCCTTGAGAGCTACCTCTCTGGACGGGGCTATACCGTGACGAGACAGCAT
GTGGGCGCCGCCAAGGATGATCGCTTCAACCTCCTGGCGCGTCCCGGTGATGATAACCAAAGCAGGAGGCCGAGG
GTGGTGGTGACGAGTCACATCGACGTTGTACCGCCATACATCCCCTACGGCATCTCCGATGACGATGAAAAAATC
AATACCGATACCATCATCACGGGGCGCGGCTCCGTAGACGCCAAAGGCAGCGTCGCTGCCATGGTCGTCGCGCTG
GAGCAACTCCGTGCAGCACAAACCATCTCCGACGCTGACGCCGCCCTGGTTTTTGTCGTGGGCGAGGAAGTCAAT
GGCGACGGCATGCGTACCTACGCCCGCTCCCTAGGCTCCGACGGTCTGCCGCCCGCCGTCATCTTCGGCGAGCCG
ACGGAGAACAAGCTGGCGTGCGGCCACAAGGGCATACTGAACTGCCGCGTCTCTGCGCGCGGAACGTCCGGCCAT
AGCGGCTATCCCTGGCTGGGCAAATCGGCCAACGCTGTCATGGTGCGCGCCATGGCTGCCTTGCTTGACGCTGAC
CTTGGCTCCTCGGCCCGCTTCGGCAATTCAACCGTCAACATCGGCCGCTTCGAAGGCGGCGTCGCTGCCAACGTC
ATCGCCGAGAACGCCACCGTCGAGCTGGCTGTTCGCGTCGCCGCCGGCTCAGAGGAAGACGGTGCAAAATTGGCG
CGGCGTGGTATCCAGTCGGTGCTCGACCGTGTCGACGATGAGGCTTTGACTATGAATTGCGTTGGGGGCTACGGA
CCCGTCAAGTGTAACTGCGATGTGACCGGCTTCGACACCGTCATCGTCAACTACGGAACCGACATCGGTAACCTC
AAGGGCAACTACACCAAATACCTCTACGGCCCAGGGTCCATCCTCGTGGCGCATGGCGCGCGGGAGAATCTGACC
GTCGGCCATCTCGAGACCGCCGTCGAGGGTTACAAGAACCTTATCCTGCACGCCCTGTCG
Transcript >Ophio5|1789
ATGCGCTTCCCAATTCTCACCGCCATACACGCTCTGCCGCTAATCGCCAGCGCCGCGCAACGTCCCCTCATCAGC
TCATCATCGACGCCCGCCTACCGAAGCGAGCTGCTCAGCCTGCACCGCTCGCTCGTCTCCATCGAGTCCATCAGC
GGAAATGAGGCCGCCGTCGGACGCTTCCTTGAGAGCTACCTCTCTGGACGGGGCTATACCGTGACGAGACAGCAT
GTGGGCGCCGCCAAGGATGATCGCTTCAACCTCCTGGCGCGTCCCGGTGATGATAACCAAAGCAGGAGGCCGAGG
GTGGTGGTGACGAGTCACATCGACGTTGTACCGCCATACATCCCCTACGGCATCTCCGATGACGATGAAAAAATC
AATACCGATACCATCATCACGGGGCGCGGCTCCGTAGACGCCAAAGGCAGCGTCGCTGCCATGGTCGTCGCGCTG
GAGCAACTCCGTGCAGCACAAACCATCTCCGACGCTGACGCCGCCCTGGTTTTTGTCGTGGGCGAGGAAGTCAAT
GGCGACGGCATGCGTACCTACGCCCGCTCCCTAGGCTCCGACGGTCTGCCGCCCGCCGTCATCTTCGGCGAGCCG
ACGGAGAACAAGCTGGCGTGCGGCCACAAGGGCATACTGAACTGCCGCGTCTCTGCGCGCGGAACGTCCGGCCAT
AGCGGCTATCCCTGGCTGGGCAAATCGGCCAACGCTGTCATGGTGCGCGCCATGGCTGCCTTGCTTGACGCTGAC
CTTGGCTCCTCGGCCCGCTTCGGCAATTCAACCGTCAACATCGGCCGCTTCGAAGGCGGCGTCGCTGCCAACGTC
ATCGCCGAGAACGCCACCGTCGAGCTGGCTGTTCGCGTCGCCGCCGGCTCAGAGGAAGACGGTGCAAAATTGGCG
CGGCGTGGTATCCAGTCGGTGCTCGACCGTGTCGACGATGAGGCTTTGACTATGAATTGCGTTGGGGGCTACGGA
CCCGTCAAGTGTAACTGCGATGTGACCGGCTTCGACACCGTCATCGTCAACTACGGAACCGACATCGGTAACCTC
AAGGGCAACTACACCAAATACCTCTACGGCCCAGGGTCCATCCTCGTGGCGCATGGCGCGCGGGAGAATCTGACC
GTCGGCCATCTCGAGACCGCCGTCGAGGGTTACAAGAACCTTATCCTGCACGCCCTGTCGTAG
Gene >Ophio5|1789
ATGCGCTTCCCAATTCTCACCGCCATACACGCTCTGCCGCTAATCGCCAGCGCCGCGCAACGTCCCCTCATCAGC
TCATCATCGACGCCCGCCTACCGAAGCGAGCTGCTCAGCCTGCACCGCTCGCTCGTCTCCATCGAGTCCATCAGC
GGAAATGAGGCCGCCGTCGGACGCTTCCTTGAGAGCTACCTCTCTGGACGGGGCTATACCGTGACGAGACAGCAT
GTGGGCGCCGCCAAGGATGATCGCTTCAACCTCCTGGCGCGTCCCGGTGATGATAACCAAAGCAGGAGGCCGAGG
GTGGTGGTGACGAGTCACATCGACGTTGTACCGCCATACATCCCCTACGGCATCTCCGATGACGATGAAAAAATC
AATACCGATACCATCATCACGGGGCGCGGCTCCGTAGACGCCAAAGGCAGCGTCGCTGCCATGGTCGTCGCGCTG
GAGCAACTCCGTGCAGCACAAACCATCTCCGACGCTGACGCCGCCCTGGTTTTTGTCGTGGGCGAGGAAGTCAAT
GGCGACGGCATGCGTACCTACGCCCGCTCCCTAGGCTCCGACGGTCTGCCGCCCGCCGTCATCTTCGGCGAGCCG
ACGGAGAACAAGCTGGCGTGCGGCCACAAGGGCATACTGAACTGCCGCGTCTCTGCGCGCGGAACGTCCGGCCAT
AGCGGCTATCCCTGGCTGGGCAAATCGGCCAACGCTGTCATGGTGCGCGCCATGGCTGCCTTGCTTGACGCTGAC
CTTGGCTCCTCGGCCCGCTTCGGCAATTCAACCGTCAACATCGGCCGCTTCGAAGGCGGCGTCGCTGCCAACGTC
ATCGCCGAGAACGCCACCGTCGAGCTGGCTGTTCGCGTCGCCGCCGGCTCAGAGGAAGACGGTGCAAAATTGGCG
CGGCGTGGTATCCAGTCGGTGCTCGACCGTGTCGACGATGAGGCTTTGACTATGAATTGCGTTGGGGGCTACGGA
CCCGTCAAGTGTAACTGCGATGTGACCGGTGAGGGAGGCATTTATAGAGGCATCCTCCTCCCCGTTCAGGTTCTC
CTGCTGACCACGAGGGCTCCCCACCGCCAGGCTTCGACACCGTCATCGTCAACTACGGAACCGACATCGGTAACC
TCAAGGGCAACTACACCAAATACCTCTACGGCCCAGGGTCCATCCTCGTGGCGCATGGCGCGCGGGAGAATCTGA
CCGTCGGCCATCTCGAGACCGCCGTCGAGGGTTACAAGAACCTTATCCTGCACGCCCTGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail